SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007556 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007556
Domain Number 1 Region: 40-158
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000113
Family Ankyrin repeat 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007556   Gene: ENSTNIG00000004892   Transcript: ENSTNIT00000007716
Sequence length 258
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:72836224:72836997:-1 gene:ENSTNIG00000004892 transcript:ENSTNIT00000007716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSFSLLFYRAVRDLKPVWMLEEMRTMETFYQDDDLKQRTYTPSEALLYAVVHDHQPYARF
LLGRYPEEALAKPSERFWCCPSSAPHLTMAVRYDRHCILRLILHKSRTHAGCLPAEDFRT
LLHFACELQRPEAVIILLGNGASPQALDRNGSTPLDVTLEKLRETSSSSARRCLDILLMF
TPKVGVKMRAALEAEPGLWRKLLGENTFGFLAKKSPAPLVLVAMQTVVKQLSPATILDSL
QELPIPTSLKPPGLPGAR
Download sequence
Identical sequences H3CH28
99883.ENSTNIP00000007556 ENSTNIP00000007556 ENSTNIP00000007556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]