SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007580 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000007580
Domain Number - Region: 646-678
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.000331
Family MYND zinc finger 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007580   Gene: ENSTNIG00000004916   Transcript: ENSTNIT00000007740
Sequence length 932
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:31952610:31955816:1 gene:ENSTNIG00000004916 transcript:ENSTNIT00000007740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRTYPPDILASTLYQGFSLNPQCEHSVSLHSSKQCDLKMIDKPEIINKRHCRSFDFIES
LDDPQSLPIEYPYKSQDKPSHLTWSDSKKRTRSKSAPRIKTTLTPVPISVSPPEAKKMRD
KPKTATEAKTPDTRENFTSNRAFLDDVHPIKLQPHPPLYVSDCFDESKPMKANVTPHVRC
RVDIKPDASVLQHTSSSPTPTPSELYSGHYRPGYHCSTSMSSSPYQHLDVHRMVSPTVPY
LTQEQRAYSNPNIPIPSFSRGYFQDDRSSLTSYGSTVTSQYDPRTRWVHTLPVRSYYTDH
LSGEPFHSAYGRPYSTSEAGSYISQTPMSRSYYGEDLRFNPYHVSSSRLFYPKSYGSPEK
HISGYSNHSSQLTPPRVRRELGLPPWYNSFEETSRLGAEAKNHSKSWDNILYSHHDREQM
VPRGRSYENLFYQARHGATADVAPQPVILNLSSSPRRYAALSLSENSLERGSASPWKTPK
GGRWYVTPEITITDNDLNAGHNQHQDVHSVSWDTPGGEKTPPPRVIHQQISNMADQSLEQ
LDELLADLVVDYKPPTSRKASEGLLDQLKQLIIEDDIKDGGSPRLENTQLLSSKSSPDTV
KDPDSGCDALQRSAEECSPDHSTDDDDTMVCANKKCKRTENMFNACLYFKSCHSCYTFYC
SRNCRRDDWENHKETCLYGRVNSVCRHILKYCRENSEIHKSFSRLAKAGYLSRGRGILFL
GFANPETAVNFMQVGLESLLMSPTYLSLRELESVKDNLGEYCKELQLAGNEYDPNECFLL
NVSVAVGELVPNRPPRVQAPTVRKYAKVSLASSSPDKKVLKKDSEMETLILTPPPGTPDI
DKEGEEGRKAREVCFVNIQRELRTRGVFLRHEYPKIYSRLCEFVESNKRFTPTTIYPIDK
RTGKQFMCMIMAASEPRTLDWLGTPHLLDDII
Download sequence
Identical sequences H3CH52
99883.ENSTNIP00000007580 ENSTNIP00000007580 ENSTNIP00000007580

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]