SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007602 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007602
Domain Number 1 Region: 903-1030,1215-1401
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.83e-49
Family p120GAP domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 382-477
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000154
Family Other IPT/TIG domains 0.0083
Further Details:      
 
Domain Number 3 Region: 474-565
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000467
Family Other IPT/TIG domains 0.024
Further Details:      
 
Domain Number 4 Region: 57-109
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000746
Family Plexin repeat 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007602
Domain Number - Region: 564-678
Classification Level Classification E-value
Superfamily E set domains 0.000105
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.059
Further Details:      
 
Domain Number - Region: 1-54
Classification Level Classification E-value
Superfamily Sema domain 0.000373
Family Sema domain 0.022
Further Details:      
 
Domain Number - Region: 689-747
Classification Level Classification E-value
Superfamily E set domains 0.000513
Family E-set domains of sugar-utilizing enzymes 0.081
Further Details:      
 
Domain Number - Region: 209-242
Classification Level Classification E-value
Superfamily Plexin repeat 0.0105
Family Plexin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007602   Gene: ENSTNIG00000004937   Transcript: ENSTNIT00000007762
Sequence length 1434
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:13392330:13412443:-1 gene:ENSTNIG00000004937 transcript:ENSTNIT00000007762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLCLQVFLGPNGEVEEYSVTSIQKNVPISSDLILDHNEEHLFIMTPNMLQKRPVAECQQH
PDCLSCLLAHDPYCGWCVLDGRCVLQSQCSRGHRSGQWLWSFDMDQQCLLVQELNPLNLS
REESQMVSLAVPGLPLLDEPESYSCMFESPSHAVVSGGRVLCQSPSPGSLPMVPLGQDSI
TISLSLRFGDVTIAARDFTFYDCTAVKQLSGRSPCRGCVLSRWGCNWCIQQHLCTHSSTC
EDGVVIYNQHSYPHLLGHDSDLDYQYDPADGFLPTSFHIRAELKLMMNPAVFKISGQRNF
KTAKLSPEVRVLTLPVNCTSPNYSIQQFFDDCAVQIFKCEKEEIGGKVCHTAEHKYGCVW
CGSAQASCLYSQSCSEPVQQTCPEHVIHNIEPLSGLLEGGTMLTISGSNLGQKVEDVLYS
VSVAGVPCSVIASLYEISSRIVCRTKASGGEKSGQVSVKVSGGDLGLSTDLFTYQDPFVM
SVSPNRGPKAGGTVLTISGRNLLTGRLSDIRITVGGVSCHIVKVYHPSNLKCVTGSSNRT
GQHGVTLHYNSGQRHLHSSAYTYTHNPNITWVNHLCVFSGGRFIYVSGHNLDVVQEPRMV
VTVSSQLVNQRGGRRGRSMVPKNSGCPENRHCSVRMLCRSPSVDSSAMGSKVTVESLLDN
LRFDFSSLSPQPFTYEPNPNLRPLNQQDPLKAYRYNPGSFIQLEGENLDLAITKDEVVVL
IGEGVCAVKTLTRNHLYCEPPPQQPSPVLNGRNREGSDSLPEFTVQMGNLNFSLGKVQYD
NLSLSTFPLEAQIGVGVGASIVALIVLIIVLIYRRKSKQAMRDYKKVQIQLENLETSVRD
RCKKEFTDLMTEMMDMSSDLVGSGIPFLDYRMYAERIFFPGHRESPLRRDLDVQECRRQT
VEQGLVQLSNLLNSKLFLTKFIHTLESQRTFSPRDRAYVASLLTVALHSKLEYFTDILKT
LLNDLVEQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFLRESAGESLYMLFRAIKHQV
DKGPVDAVTGKAKYTLNDNRLLREDVEYRTLTLNVLVQGAGLSENQPLPTKVLDCDTITQ
VKEKLLDQVYKGTSFSHRPHSDSLDLEWRSGVAGHLILSDEDLTSVVQGSWKRLNTLQHY
KVPEGATVALVARHSKHIHHDNHDYMAGEKTPMLEDADEGGVRLWHLVKASEEPELPKHR
RGSLRERERAKAIPEIYLTRLLSMKGTLQKFVDDLFTVILSTSRPVPLAVKYFFDLLDEQ
AGQHGISDSETIHIWKTNSLPLRFWINIIKNPQFIFDVQASDHVDAVLSVIAQTFMDSCT
IAEHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTVSASDQEMNSALAELSRNYSGE
LNYLVALHELYKYINKYYDQIITALEEDSTAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences H3CH74
ENSTNIP00000007602 99883.ENSTNIP00000007602 ENSTNIP00000007602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]