SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007614 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007614
Domain Number 1 Region: 236-558
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.31e-89
Family Protein kinases, catalytic subunit 0.0000000862
Further Details:      
 
Domain Number 2 Region: 1-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 1.49e-22
Family PB1 domain 0.0000966
Further Details:      
 
Domain Number 3 Region: 100-168
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.34e-17
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007614   Gene: ENSTNIG00000004949   Transcript: ENSTNIT00000007774
Sequence length 578
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:73149769:73159244:-1 gene:ENSTNIG00000004949 transcript:ENSTNIT00000007774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VKIKAHYRGDMLITDIPASLTFDQLCEEVKMLCSVARLQPITLKWMDDEGDPCTISSQRE
LQEALRLHRRHRRSGLLLHVFPSVPQQPGMACPGEDKSIYRGGARRWRRLHRVNGHLFQT
KRFTRKAPCGSCADSIWGLRTQQGYKCINCKVLLHKRCHRLLPLTCPMLMDPVMPSQEPP
PDDKSEEDLPAVHGEDADGSETPLFSNMLLTMKDISAVVDGIGGMKLSQDLVLGLPDFEL
IRVIGRGSYAKVLLVRLKKNDQMYAMKVVKKELVHDDEDIDWVQTEKHVFEQASSNPFLV
GLHSCFQTQSRLFLVIEYVKGGDLMFHMQRQRKLPEEHARFYAAEICIALNFLHEKGIIY
RDLKLDNVLLDHDGHVKLTDYGMCKEGIQPGDTTSTFCGTPNYIAPEILRGEDYGFSVDW
WALGVLMFEMMAGRSPFDIVTDNPDMNTEEYLFQVILEKPIRIPRSLSVKAASVLKGFLN
KDPKDRLGCQVQMGFTDVQSHTFFRSIDWNQLEQKQVTPPFKPQISDDYGLENFDTQFTN
EPVQLTPDDEDVIKRIDQSEFEGFEYINPLLLSMEESV
Download sequence
Identical sequences H3CH86
ENSTNIP00000007614

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]