SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007622 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007622
Domain Number 1 Region: 532-720,1097-1254
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.55e-108
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.00000403
Further Details:      
 
Domain Number 2 Region: 301-419
Classification Level Classification E-value
Superfamily HSP20-like chaperones 1.29e-34
Family GS domain 0.00000727
Further Details:      
 
Domain Number 3 Region: 823-874
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0000000000924
Family MYND zinc finger 0.011
Further Details:      
 
Domain Number 4 Region: 54-139
Classification Level Classification E-value
Superfamily HSP20-like chaperones 0.000000000872
Family GS domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007622   Gene: ENSTNIG00000004957   Transcript: ENSTNIT00000007782
Sequence length 1367
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:73301625:73311492:1 gene:ENSTNIG00000004957 transcript:ENSTNIT00000007782 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRAGRRRSGPPRGVPAEASSKKKQKDRANQESREAKRAVAVVDAVIAEVRKDVFVDWKQN
VNEVTVRLRCGDGIQRKEDVSTSFTDKSCHVSFPDGRQWSCQLQEEIEASCSRVQYREKG
GFLHLIMQKKIPFHTWPSLKLIEEPKVSRPQPRLQPQPPASPPHTEARRSSAKAARVGKG
SSKSKPASTNSVHKTADGPSSKNRRTGKAEEAASGGKGDHSGSRAANGPEEQPKEEELRL
GPFQEQTPGPAWDGSSHTSTAEVRKPPPPHPSTPAGRMGSDCEEEKQDQPKDEPCLESRQ
QEGWESLGPMVDLQYVKNDSYEKGTDLMVVNVYMKGLSRDTTRVLFREQHFTLFFQTSDG
NFLRLHSDCGPNTHFKWQVKLRNLIEPEQCSYSFTPSRLDITLKKRHSQRWGGLEAPASQ
GAVGGAKVAVPSSPACMEKAQPDSSKHSLPAQQEPPRVQEEKAKVCKASARAEEGSLDPG
APSTVSEHVALTKAEPTFTMPKPTCMVQPMTHALPASKEPHEDEEEKKVCLPGFTGLVNL
GNTCFMNSVIQSLSNTRELRDYFLDRAFEGEINCSNPLGTGGRLAIGFAVLLRALWKGTH
HAFQPSKLKAIVASKASQFTGYAQHDAQEFMAFLLDGLHEDLNRIQNKPYTETVDSDGRL
DEVVADEAWQRHKMRNDSFIVDLFQGQFKSKLVCPMCSKVSITFDPFLYLPVPLPQKQKV
LSVYYFAKEPHKKPIKFSVSVSKENSHTAEVLESISRSVRVKAENLRLAEVGKNRFQRMF
LPSHSLDTVSSSDMLFCFELLSKEMAKEKVVLLRVQQKLQVPNIPISKCAACLKPPTSEE
DKLKRCTRCYRVGYCNQVCQRTHWPNHKSLCRPNTENVGLPFLVSVPESRLCYSRLSQLL
EGYSRFSVDVFQPPFHSGRTSPDSRCAGDLPVLPAGCPEPGRPSDQALCSSSAGSADPEP
DGPSLQPGQQQCAQASAPPAGEQFSSVSCCSFDPHSEKETSCEKTVRPEAAVTGYQQPSE
VSSAHASQFFISLLDSNNKEQRLDEKEDALANLPEDATLELVWKNNERLKEYVLVSSKDL
DYEEDPSSLSETARAGHFTLEQCLNLFTKPEVLAPEEAWYCPKCQQHREASKQLLLWRLP
NVLIIQLKRFSFRSFIWRDKINDMVDFPIRNLDLSRFCIGMKDEMQQPVYDLYAVINHYG
GMIGGHYTAYARLPSDKNSQRSDVGWRLFDDSTVTMVEESQVVTRYAYVLFYRRRNSPVE
RPAHFHRPGGAESPTAAGAAASQASLIWRQLEEEEEGPREGSPRLLWRRQAQQNREEEDA
DIAGVSLQHPQHPADDCGHFFVLGTLAAVFALLVNVLYPFLSTLELA
Download sequence
Identical sequences H3CH94
ENSTNIP00000007622 99883.ENSTNIP00000007622 ENSTNIP00000007622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]