SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007661 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007661
Domain Number 1 Region: 52-172
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.9e-20
Family Synaptotagmin-like (S variant) 0.058
Further Details:      
 
Domain Number 2 Region: 223-271
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000217
Family CUE domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007661   Gene: ENSTNIG00000004995   Transcript: ENSTNIT00000007822
Sequence length 274
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:30235142:30238819:1 gene:ENSTNIG00000004995 transcript:ENSTNIT00000007822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATTISTQRGQQVYIGELPQDFLRITPTQQQQQVHLDAQAARQLQYGGSLGTVGRLSITV
VQAKLAKNYGMTRMDPYCRIRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEI
FDERAFSMDDRIAWTHVTIPENLREGTVVDEWFSLSGRQGDDKEGMINLVMSSTVSTLTD
LYQTDQNDPHQQKISDVVSLGVPAVYNQGMVPMTMPASMAPAGAQEPVCSEEDLKALQDM
FPNLDNEVVRTVLDAQRGNKDAAINSLLQMAEEL
Download sequence
Identical sequences H3CHD3
99883.ENSTNIP00000007661 ENSTNIP00000007661 ENSTNIP00000007661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]