SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007677 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007677
Domain Number 1 Region: 4-305
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 8.89e-50
Family FCH domain 0.0083
Further Details:      
 
Domain Number 2 Region: 475-652
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-48
Family BCR-homology GTPase activation domain (BH-domain) 0.00022
Further Details:      
 
Domain Number 3 Region: 700-762
Classification Level Classification E-value
Superfamily SH3-domain 2.1e-17
Family SH3-domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007677   Gene: ENSTNIG00000005011   Transcript: ENSTNIT00000007838
Sequence length 901
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:73605583:73615462:-1 gene:ENSTNIG00000005011 transcript:ENSTNIT00000007838 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPDLRAQLTDQVKVLDSQVEVKQQQLSDLSEFLRRRGDIEAEYARALDKLTERFTHKTKK
KEQWGQSVCEVWSVLLNQTRLESREHAALDTCCNALTQRLVHVSEDTHRLHKRSKEVGIQ
MQEELLKVTTELQTALKTYNQYHTDCLIAEGKLKDAERLEERHTGKSADLGLSQSGGQRR
SSVKKMERLMEKRHGRVQETQLKCTKARNDYLLNLAAANAAMNKYYLQDVSTLIDCCDLG
FHLSVERVMRCYLASRGRIQKAEEAGVRQLEAAVASLDQGGDRDALLQQHDTAFCLPFRF
HYHPHEGDQVCEVSAESQVRYELETRFQQLQSRLAAVTLETEEVSKTLKATLTALLDNVC
DGDCDPSPDLPSSQSHEPLGGGPAPKLTLAKRRANQQEAETYYLTKVKEFLTSSSLSSKL
QAKHDLLQEAIQKAEAVNSDPSRMQCARSLRVRKSRPVSQFGHTLFTTDIVCYLQQIPVV
VESCIRFINLHGLHHEGIFRVPGSQRVINLLRDAFERAGEDPLSDSECDLDSVAGVLKLY
FRGLEPPLFPYDSYPQLHLSRAEVEEETERAAHIKAIVSSFPRPLLIVLRYLFAFLNHVS
QYSDENMMQPYNLAVCFGPSLLRGVEADEAVTQQPQVNDLVKTMILQHDLIFPGQPELAG
PVYEKHMTLEQEYCEPITEEGEGEPEHLPSEDGWVCAELEAVALFDYVARSPAELSLKVG
ELVVLHSKASCDWWRGEVGGVKGLIPHKYISVLDGTPRPRAPAGRWRRGRGSGGAPPLLG
SHRSNAPTGCGSTATAPRCQGDRGEARPARRRPRPRPHATCPQELISRQMNSVFKELLSR
QSPGQQFSPASAPTPAGAPPSGGSPPPAGAHGHGFSSGHAGSGVRASSSSPDPLFRPKQP
F
Download sequence
Identical sequences H3CHE9
99883.ENSTNIP00000007677 ENSTNIP00000007677 ENSTNIP00000007677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]