SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007714 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007714
Domain Number 1 Region: 47-187
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.7e-45
Family Transglutaminase core 0.0000121
Further Details:      
 
Domain Number 2 Region: 1-46
Classification Level Classification E-value
Superfamily E set domains 0.00000000189
Family Transglutaminase N-terminal domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007714   Gene: ENSTNIG00000005049   Transcript: ENSTNIT00000007875
Sequence length 189
Comment pep:novel chromosome:TETRAODON8:Un_random:2076660:2077996:1 gene:ENSTNIG00000005049 transcript:ENSTNIT00000007875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ITVHICSPVLSSVGLYRLLLHTQTFQSRRTYMLGSFVLLFNPWLKEDPVYMPLEVQRDEY
IKSDYGLVFMGSHPNISRRPWLYGQYQPGVLEACLQILQVSPQHLSDAHKDYILRGDPVY
ISRVVCAMVNCNDDLGVVAGKWQGSYNDGVRPTEWGGSADILLRWASSKCSPVRYGQCWV
FASVLCTGD
Download sequence
Identical sequences H3CHI6
ENSTNIP00000007714 ENSTNIP00000007714 99883.ENSTNIP00000007714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]