SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007745 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007745
Domain Number 1 Region: 31-82
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000628
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 2 Region: 99-179
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000114
Family I set domains 0.07
Further Details:      
 
Domain Number 3 Region: 1-35
Classification Level Classification E-value
Superfamily Sema domain 0.0000706
Family Sema domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007745   Gene: ENSTNIG00000005080   Transcript: ENSTNIT00000007906
Sequence length 275
Comment pep:novel chromosome:TETRAODON8:Un_random:74388556:74391184:1 gene:ENSTNIG00000005080 transcript:ENSTNIT00000007906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTPITSMDISVKRQALYVGSPAGVALVKLHRCETYGNACAECCLARDPYCAWDGSVCTRY
LANSKRRFRRQDIRHGNPMLQCSDQNLSAEDLDGTDDRVVFATENNSTFLECIPRSPQAT
VTWLVQRDDRKEEVKLDDRIIATDQGLLFLRVFQQDEGSYTCRSREHGFTQTLARLSLQV
LQGETVDDLLTRDNAGLSDPFKDRSTSRTWFKDIMQLIGPSNLPHVEEYCERMWCNDKLR
RKHKSMMEKYRQAQESARKVRSKSPGERNRTPRDV
Download sequence
Identical sequences H3CHL7
ENSTNIP00000007745 ENSTNIP00000007745 99883.ENSTNIP00000007745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]