SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007746 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007746
Domain Number 1 Region: 43-522
Classification Level Classification E-value
Superfamily Sema domain 4.19e-182
Family Sema domain 0.00000000000592
Further Details:      
 
Domain Number 2 Region: 518-569
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000523
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 582-665
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000212
Family I set domains 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007746   Gene: ENSTNIG00000005081   Transcript: ENSTNIT00000007907
Sequence length 771
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:74401267:74416254:-1 gene:ENSTNIG00000005081 transcript:ENSTNIT00000007907 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWWLLLISCLSFSGSSLFLLGLAAAHASSGTMTPPRMKLSYKELQQFHGVRRFELERSCC
FSALLLDEERGRLFVGAKNFRAVAVTRQHRQIYWPAPVDWREECNWAGKDITSDCVNYVK
IVHHYNRTHLYACGTGAFHPTCAFVEVGHRMEDHMFRIDPSKVEDGKGKSPYDPRHNAAS
VLVGDELYAGVATDLMGRDFTIFRSMGRRPSIRTEQHDSRWLNEPKFVGSFWVPESENPD
DDKVFFFFRETAVEAQGLGKSTYSRIGQLCRNDMGGQRSLVNKWTTFLKTRLICSVPGAD
GSDTYFDELRDVFLLQTRDRKNPLVYTVFSTSSSSVFKGSAVCLYSMNDIRRAFLGPFAH
KEGPNYQWVPFQGKVPYPRPGMCPSKTFGSFESTKGFPDDVIQFARHHPLMYNPVYPMTR
RPIFVRTNVDYSFTQIAVDRVGAADGQYDVMFIGTDKGTVLKVINVPKGSWNNMEELLLE
ELEVFKDASSIINMQISSKRQQLYVGSDTGIAQVPLHRCSVYGKACAECCLARDPYCAWD
GTSCTRYLPNTKRRFRRQDVRNGDPNTLCSGDHHKHRVAEKKLFGVEGSSTFLECIPKSL
QARVTWTFQKHPQNPREEVRLDDRILQTDRGLLIRRVLKRDIGVYQCHAMEHGFTQTLLG
ITLEVVPSASSSASNLPSDAPVRLDPRSGGAPPMTNQKVWYRDFMQLVDHPNLSTVDQIC
EQVWARKNAAVDQGPSVRPGNKKWKHLQEIRKGRNRRTHDGKPNPRAPRSA
Download sequence
Identical sequences H3CHL8
ENSTNIP00000007746 99883.ENSTNIP00000007746 ENSTNIP00000007746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]