SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007749 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007749
Domain Number 1 Region: 44-367
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.27e-113
Family Bee venom hyaluronidase 0.00000349
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007749
Domain Number - Region: 412-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00607
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007749   Gene: ENSTNIG00000005084   Transcript: ENSTNIT00000007910
Sequence length 434
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:74486452:74488254:-1 gene:ENSTNIG00000005084 transcript:ENSTNIT00000007910 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQPAWAAMALVLPLLLLAHLTRSSLPRTLPEAAAAAGPVLRDRPFVVVWNMPTAHCQKHY
NVCLDLRDFDIVENRRQDFQGQKMTIFYRDHLGMYPFISREGGKVNGGIPQLGHLSAHLS
LAVTQISSLLRPNFTGLAVIDWEEWQPLWEKNLGEKMEYRRLSKRLVRQERPGLSEKAVM
SLARGMFEGGARKFMEVTLQAAIRTRPEGLWGFYGFPVCSNKHKRKTDDTYTGRCHTGSR
RQNDRLSWLWGRSTALYPSIYLPRGLAGSSRAALMVRYTLLEALRVASVWRHGGTSSGAT
PVLPYARLAYTHTLAFLSKTDLEHTLGESAALGAAGVVLWGELEFAKSERQCLLLRDYIH
TVLGPFIRALRADTQLCSLQLCRGNGRCARRHLGSGRTFSSGPAQTSDPEKAKHFTCQCY
RGWTGQGCHQKIQN
Download sequence
Identical sequences H3CHM1
ENSTNIP00000007749 99883.ENSTNIP00000007749 ENSTNIP00000007749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]