SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007785 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007785
Domain Number 1 Region: 276-449
Classification Level Classification E-value
Superfamily vWA-like 2.67e-26
Family Integrin A (or I) domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007785   Gene: ENSTNIG00000005117   Transcript: ENSTNIT00000007946
Sequence length 730
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:19863863:19879461:1 gene:ENSTNIG00000005117 transcript:ENSTNIT00000007946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMTCCGLLTIEKKPVPLKGVEVDVEVRDHVASVVSTLNYENSEDNPLEVVFVFPLPGDAA
VCHFSAAIGQKQIVAEVKEKQQAHEEYDDALSSGQQAFLLEESDESPDIFSLRVGSLPPG
QTASIRLEYVIELALQADHGLRFCLPTVLNPPLPTCSVQGSSLPAAQVPYTLALRLRVSS
TRPVSKVESNCSLEPLEHLNAEKTQTTVKLAAGHKCDRDVELLIYYLDAHQPAALVEAGQ
TSADPLSLMGDPVVMLSLYPDFPQAVLSSPASCGEFVFLLDCSGSMGSPLSRSKTNETRI
ASARDTLLLLLKSLPMGCYFNIYTFGSSFEHIFPKSVEYTQKTMDEALQKVKRIEANLGG
TEILKPLEHIFSQTCVPGQPRQLFVFTDGEVFNTKEVIGLVKKNSGSHRCFSFGIGEGAS
SALINGLAREGGGHVQFITGTDRMQPKVMQSLTFALQPAVTNVSLVWDLPKEASVTVLSP
PIISIFQGQRSLVYAQLSGLSSAAAEGHVTLNYSLAGQPYQNKLHFSLNATQDSRLTVHR
LAARTLIRSLEMEGETGGEKVKEEVVKVSVQSGVSSTFTAFIGVNDAGEVIQGPLLSRHI
PAPEILGCFFFTKSADLEQQAHPTQTCVPGQPRQIVYVQGRRRTRPVHHGHGQDAAQTST
QPKTAGLMRCCAPVMALARESSSEPPSQDPLLQLVSLQTASGCWSLDSHLAAVLGKTIDE
LQKAKPQAKG
Download sequence
Identical sequences H3CHQ7
99883.ENSTNIP00000007785 ENSTNIP00000007785 ENSTNIP00000007785

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]