SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007806 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007806
Domain Number 1 Region: 567-627
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000162
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 2 Region: 29-76
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000115
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 3 Region: 496-541
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000209
Family TSP-1 type 1 repeat 0.00091
Further Details:      
 
Domain Number 4 Region: 621-678
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000162
Family Complement control module/SCR domain 0.0031
Further Details:      
 
Domain Number 5 Region: 82-119
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000116
Family LDL receptor-like module 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007806
Domain Number - Region: 447-485
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000527
Family EGF-type module 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007806   Gene: ENSTNIG00000005137   Transcript: ENSTNIT00000007967
Sequence length 839
Comment pep:known_by_projection chromosome:TETRAODON8:12:8686203:8690472:-1 gene:ENSTNIG00000005137 transcript:ENSTNIT00000007967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSSQLSVVTPFLLFLFISKGSPRLCNLGINCQWGPYGDWSECDGCTKSQTRSRVVAVYAQ
FGGNSCPGGRTETRPCETTRGCPLEDGCGGRFRCRSGKCISQSLVCNGDQDCEGDGLDEH
CPSDRFIICTQSTLPPNVELLGLGFDVVSEQTRASVINTKSFGGQCRTIYSGVHQTIYRL
PVSTLQYSFMVKVQNDFSDEMFSSKWHYAKSIVQRERASGTTTGYRNYDFRETEDRTRMQ
KLLVLKNEIEVAQFQSNSPQYIPLSEELWKALVKLPSVYDYAAYRKVLERFGTHYLSEGS
LGGTFKVVAKIDEETQRYMRTESSEYNECEETKYWILFFSFTRKTCRSGSSNSRFSTGPP
GTRSGNHLSRVDVVGGGVQHSAALSTMSLDDPNKNWEMYSNWADSVRSFPQVTKQKLRPL
SELVKEVQCAGVKKMYLRRAIEQYLSESDPCHCQPCRNNGLVFTDGNTCKCVCKPGTSGL
ACEQGTEIEGQQGVIQGSWACWSTWSSCNGARRSRSRSCSNPAPQNGGQYCSGESTETSD
CDEDELSYLKTMEPQCFDQTLPESHKCETPPPLINGYIMEPKDIYLVGSKVEYTCISGFH
LGSSTIECTENKTWSSRPGLCIRSACQLGSLAEGVMAYPINGAYSIGDTVTLSCPEGRQL
LGESEITCDPSLNFSPDPASISCSPVKRQQTLLPPEVQCQPGKKPSKGKCVCKMPFECRS
SLEVCTTVAVTNRPFLLTVCKMHALRCLGKRYLIAEDGVCEWPQRNTTGCTNCHLWELCD
DQTNECRCKDSADCSDPGVNVCVRVGADGQNQTMSECEAGLKRCKGEQVSVVSILPCTG
Download sequence
Identical sequences H3CHS8
ENSTNIP00000007806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]