SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007818 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007818
Domain Number 1 Region: 225-355
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-32
Family Cadherin 0.00053
Further Details:      
 
Domain Number 2 Region: 436-559
Classification Level Classification E-value
Superfamily Cadherin-like 5.89e-30
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 335-439
Classification Level Classification E-value
Superfamily Cadherin-like 5.89e-23
Family Cadherin 0.0027
Further Details:      
 
Domain Number 4 Region: 128-229
Classification Level Classification E-value
Superfamily Cadherin-like 1.02e-22
Family Cadherin 0.0048
Further Details:      
 
Domain Number 5 Region: 550-660
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-17
Family Cadherin 0.0022
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000007818
Domain Number - Region: 30-96
Classification Level Classification E-value
Superfamily Cadherin-like 0.000228
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007818   Gene: ENSTNIG00000005148   Transcript: ENSTNIT00000007979
Sequence length 942
Comment pep:novel chromosome:TETRAODON8:1:6675693:6798900:1 gene:ENSTNIG00000005148 transcript:ENSTNIT00000007979 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMGDKGLSALRPILLLAVFFAALDLVHGDLSYSVPEEMKRDSVIGNVAKDLGLDVRVLSS
RKARVDFGGTRKRYCDMNLRTGDLITSERIDRESLCGKKASCLVTVDLVLENPLELHRVS
LHVQDINDNSPQFREDLIEMEIRESADKGTRFSIEEANDADIGQNAVQRYILQKNDNFIL
SVDNKKVELVLENKLDREKQKEMHLLLTAVDGGSPQRSGTVVIHVTVLDANDNAPVFSQS
VYKSSLPENSPLDTLVITVSAADADEGVNSEITYGFDHVLEDDENVFLLDTKTGVVRVNG
AIDYETTATFELRVTAKDGLGLTSYAKVIIDVTDVNDNAPVIHLKSLTNPIPENVSPGSE
VGIINVQDRDSENNRQVRCSIQQNVPFKLVASIKNYYSLVTTGQLDRELVSDYNITISAT
DEGSPPLSSSKSVHLSVADVNDNPPVFEEQSYSAYVSENNRAGSTLCSVSARDPDWRQNG
TVIYSLLAAEVSGAPVSSYVSVNGDTGVIHAVRSFDYEQLRSFKVHVMARDNGSPPLSSN
VSVSVFVSDVNDNPPQILYPAPEGNSFMTELVPKAAHGGSLVSKVIAVDADSGQNAWLSY
HIVQSSDPGLFTIGVHSGEIRTQRDISESDSMKQNLIVAVKDNGQPSLSATCSMYLLISD
NLAEVPELKDISYEEKNSKLTSYLIIALVCVSTFFLTFIIIILGVRFCRRRKPRMLFDGA
VTIPGAYLPPNYADVDGTGTLRSAYNYDAYLTTGSRTSDFKFVTSYNDNTLPAEQTLRKS
PSDFADVFGDGDSSPEQKPPNNDWRFTQGQRPGPSGETGGTETECMDRPWPQPPTEAEQL
QALMATANEVSEATANLGPGTMGLSTRYSPQFTLQHVPDYRQNVYIPGSTATLTSNPQQQ
QATAQQAAQQALPPPQASAQPEPPKAAQTPASKKKSTKKEKK
Download sequence
Identical sequences H3CHU0
ENSTNIP00000007818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]