SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007847 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007847
Domain Number 1 Region: 1572-1652
Classification Level Classification E-value
Superfamily SMR domain-like 6.02e-19
Family Smr domain 0.0000553
Further Details:      
 
Domain Number 2 Region: 377-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000000259
Family Nucleotide and nucleoside kinases 0.0079
Further Details:      
 
Domain Number 3 Region: 51-98
Classification Level Classification E-value
Superfamily UBA-like 0.0000000621
Family CUE domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007847   Gene: ENSTNIG00000005174   Transcript: ENSTNIT00000008008
Sequence length 1653
Comment pep:known_by_projection chromosome:TETRAODON8:18:270805:279870:-1 gene:ENSTNIG00000005174 transcript:ENSTNIT00000008008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRKKKTDQSPARIPGWTPEGGSFDHNTGQRGPGQIDSAMTENFPSSTLLPGSEKEGILK
GMQEMFSHLDPDVIYLMLSECDFKVEIATDSLLELSVAAEGADSGPSPISGFERSVSALL
SPPLLSDSRPDPDSNDHPLPPRSLSTDPLGGELDLLVDQELETLTMQQEQCSSQPSSSLP
PPFIVNQVLPELLESSLQPGSRRSPGSQVGQTSGAPSLLDPFSTWEVKMEKSLVDFTQSV
AEASTGSPKPQLDLGASGRPSAFQVYKKQQPLQAVGGARAKVSLLTQEPCGSLKSPWNID
ASVFTPHGQNQDPAFITPVAHLPSNLTSQPWQTVPWLNRSPIGQAPLRPSATIPKSWAPS
APQSPAHHNKLRLQGRVLVLLRGAPGSGKSTLAKALMEHNPGAVILSTDDYFTCTGYYQF
DPSALGEAHEWNHKRAKEAFERGSNPIIIDNTNLQGWEMRPYVVQAVKHGYKVLFREPDT
WWRYKPRELVKHTKHSVPLETIRHMLTKYERIVSIQSILGPQIKFEQSQLLENESSKLPS
SETHCPDLVGQPESSHPHLFSSLPDVSLIGHNSETEMAGACEPIESGSLRFQPTGTAAEY
PEIPQVDKDVDFDEVTGMDAQMELNHQTVGQAIPDCIVESVMNEDHQDDEVPVAFCETIG
QRVRRERPSRRSCFDNLEPADLVKDTNQSDRKMGARERTKTEETQTSELLRREGEQGIPK
MDFEGDWPSEGVLEQRQVRRRERRKERNSKTDEADSQSSSETQNGLQPEANRTEFQKLLD
LIQTGVADIQIDNFTSSSLSSSSEEEEPEQNTTNSSSNSNERELDMPVNHNQGELPDFVL
DQKMSDSDNTEEGNTETGSPSLLPANTSRLLAHNNQMAPSETVEANARRDGNAEGSSCIG
GSQERKQRQGRRSGKQCKLALTFTQNCPSSVDSPAGSVNPSSIAQPRIPSPPVPVGGCCS
QTEPQDFAFLWRLSNQNNPDEEFITTYSKLQNITVLSGNSCRFELATAGTPAVHARDHKE
VPYRVVHDKSTQVEDKELGLIQDRLESLRILSRHFKLVSFDTLEDLYDKCHQDLEWTTNL
LLDSGEIFFKEEEDVDPAAKHGAEDEGNGIKFVVENIHPDVKEKHRTENQPVEFGDETVQ
SATEAVGESDQSSSNTSGGHLESAVMDEGRSETPSLLETSQTNTCVNPEQDLGSGGDQDI
GAWGGNMDDGLVIEEAITENEEELASMEAVSALLQAELNRIEEEEKQKEKEMSGRRHTGA
GRSQHLDIQTVELKLPTEVALQLIELFGPVGVDPEKADSTDDCAVQMDLNLAKLIHQKWK
ESIQEKQRQATLSFLSLKNVSTNWGESDKAKPGPLLPNGRPEGYSQMPFMDHWNVSHPHI
SLRDIIKEEQALHDNMEKKRKSLADLDRRDGASLLKENQLYSLFPSIDRHFLQDIFRDHN
YSLTHTELFLRSLLDEEPVKTVVAPPAPRTDHYRANSKERETKQKPAASTKPEYQDTVDP
EYEDFRAEASLQRRRQLESFAKAAEAFKQGRKEVASFYAQQGHVHGKLMREANHRAAVHI
FERVNSSLLPQNILDLHGLHVDEALDHLVQVLQEKTTAYEKGLCRPQLSVITGRGNHSQG
GVARIRPAVINYLTNAHYRFTEPKPGLVLISLK
Download sequence
Identical sequences H3CHW9
ENSTNIP00000007847 ENSTNIP00000007847 99883.ENSTNIP00000007847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]