SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007887 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007887
Domain Number 1 Region: 702-955
Classification Level Classification E-value
Superfamily SET domain 2.07e-80
Family Histone lysine methyltransferases 0.0000402
Further Details:      
 
Domain Number 2 Region: 438-678
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.69e-66
Family Ankyrin repeat 0.0000823
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007887   Gene: ENSTNIG00000005211   Transcript: ENSTNIT00000008048
Sequence length 997
Comment pep:known_by_projection chromosome:TETRAODON8:4:9683349:9690500:-1 gene:ENSTNIG00000005211 transcript:ENSTNIT00000008048 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRKKKRRMGTYSLVPKKKTKVIRQKTVLEIFKELQQTAAAKSPQQNVCKDKTEEVVTMNG
EKIENASEEEESEEVDSEETEEPVSAIEETSEPISQGRARKSRSQSSLEKKRPEEEGTES
DLSSESSLKKRLKKKTKADSAWLRPTRKRKKRIKAKAHTQIGERGEYTQIPSAEPVSLNK
SEELSVPSKNKDLKSLLLNLSESLTSAIEEAQELPLCSCRMETPKSREILTLADRKCMAT
ESIDGQLSRCQGAILKHEMMRPSNSVQLLVLCEDHRNGMVKHQCCPGCGFFCRAGTFMEC
QPDISISHRFHRACASVLKGQSFCPHCGEEASKAKEVTIAKADTTSTVPPAIVHGGTTAA
VLEGRADTTTGSKAEISLLDRLDISPVPGSSRFTILQPRSGTTDQSPVPLGPPRETLESI
LLALDTEKPKKLRFHPKQLYHSAKQGELKKVFLMLVDGIDPNFKMESQNKRTPLHAAAEG
GHSEVCHMLVQAGANLDICDDDHRTPLMEACENNHMETVLYLLRAGANATHKDVEGFTCL
HLAAKSGHYTIVEHLLSTGLININCQDDGGWTPMIWATEYKHVDQVKLLLSKGADISIRD
KEENICLHWAAFSGCVDIAVLLLDANCDMHAVNIHGDSPLHIAARENRLDCVTLFLNRGA
NVFLKNREGETAPDCCSHTSKAWAVLQANRKERGSKISIDKAEEKILHSDIALGHERVPI
PCVNSVDSEPCPDGYKYIPENCVTSPMNIDRNITHMQYCVCKENCSTSICMCGQLSLRCW
YDKTGRLLPEFCREEPPLIFECNHACSCWRSCKNRVVQNGLRTKLQLFRTSKKGWGVRAH
QDIPQGTFVCEYVGEIISEAEAEMRQNDAYLFSLDDKPQDLYCIDARFYGNISRFLNHMC
EPNLFACRVFTTYQDLRFPHIAFFASENIKAGEELGFDYGKHFWEVKSKLFNCECGSSKC
RYSSAAMATLQADSTPEDQQQPSASPDTSSSNSPSSP
Download sequence
Identical sequences H3CI09
99883.ENSTNIP00000007887 ENSTNIP00000007887 ENSTNIP00000007887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]