SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007896 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007896
Domain Number 1 Region: 368-593
Classification Level Classification E-value
Superfamily vWA-like 2.57e-61
Family Integrin A (or I) domain 0.00011
Further Details:      
 
Domain Number 2 Region: 16-204
Classification Level Classification E-value
Superfamily vWA-like 2.62e-55
Family Integrin A (or I) domain 0.00027
Further Details:      
 
Domain Number 3 Region: 202-327
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-16
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 327-371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000339
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 602-647
Classification Level Classification E-value
Superfamily Chicken cartilage matrix protein 0.000000458
Family Chicken cartilage matrix protein 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007896   Gene: ENSTNIG00000005220   Transcript: ENSTNIT00000008057
Sequence length 648
Comment pep:known_by_projection chromosome:TETRAODON8:11:11916341:11920148:-1 gene:ENSTNIG00000005220 transcript:ENSTNIT00000008057 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAALRLPPSPGPEQKCRSGPVDLLFLIDSSRSVRPHEFETMRRFMIDILNTLDIGLNSTR
VGVVQYSSQVRSEFSLRSHASLDSMVKAIQEMVPLAQGTMTGLAIRYTMNVAFTAAEGDR
PKVPNVVVIVTDGRPQDRVAEVAAEARERGMEIYAVGVARADMTSLRAMASPPFEDHVFL
VESFDLIHQFGLQFQDKLCGADLCVESDHGCEQVCESSPGSFRCLCLPGFTLNHDGKTCS
AIDLCSEGKHDCQQICVSSPGSFTCGCGPGFRLNQDQKTCTMIDYCSHGNHSCDHECVSV
LSGYHCQCNHGYRLLDNGWTCRAIDLCSEGKHDCQQICVSSPGSFTCGCGPGFRLNQDQK
TCTDVDLCNSLDHGCEHQCVNTPGSFYCACADGRSLQEDGKSCGTCKSANIDLVLLIDGS
KSVRPQNFELVKKFVNQVVDSLDVSPQGTRVGLVQYSSRVRTEFPLSMYHSAQEIKAAVM
KVEYMEKGTMTGLALKHMLENSFSEAEGARPARRHVPRIGLVFTDGRSQDDISEHARKAK
EAGITMYAVGVGKAVEEELREIASDPVEKHSYYSADFTTISTIAENLKLNVCPEESQGEL
EVKDPCACDRLVEFQQATMSSLEQLGALTRGPLAGMTSRLEQLEKQLL
Download sequence
Identical sequences H3CI18
ENSTNIP00000007896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]