SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007897 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007897
Domain Number 1 Region: 132-289
Classification Level Classification E-value
Superfamily DNA-binding protein LAG-1 (CSL) 8.24e-56
Family DNA-binding protein LAG-1 (CSL) 0.0000132
Further Details:      
 
Domain Number 2 Region: 2-134
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.07e-47
Family DNA-binding protein LAG-1 (CSL) 0.00011
Further Details:      
 
Domain Number 3 Region: 291-402
Classification Level Classification E-value
Superfamily E set domains 1.01e-33
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007897   Gene: ENSTNIG00000005221   Transcript: ENSTNIT00000008058
Sequence length 456
Comment pep:known_by_projection chromosome:TETRAODON8:11:11925341:11929616:1 gene:ENSTNIG00000005221 transcript:ENSTNIT00000008058 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DQSVTILHAKVAQKSYGNEKRFFCPPPCVYISGHGWTAMEEPLQVDSCSQSQADAFKLVF
DQQSNSKVRQSQLGFQMFACAKSLFISDQDKRKHFCLLLRLFLGHRQEVGLFQSRLIKVI
SKPSQKRQSMRNADREISSCSRVALFNRLRSQTVSTRYLSVDRGAFIVSARQWTAFTITA
LVSDHHSGHRDVLSEGFICDGCVVQLVCTESGVALPPMVIRKVNKQHAILDVDEPVSQLH
KCAFQFRDGPHAFLCLSNDSVVRHQASCSPREPSRVVLNEGSCWTIIGVEAVEFTFNRGL
AAAPAPVTPFPVIAGLEVNGGGHVAMLELHGENFSPHLKVWFGNTETDTMFRSPRSLLCV
VPDVSVFVDGWRCARQPVTVPLSLIRADGLIYRSSFSFTYTPEIQPPPPASLRGAAGGVH
QSQLPPLHAETNTEFQFLGRNLVSVSTPSSSSRISS
Download sequence
Identical sequences H3CI19
99883.ENSTNIP00000007897 ENSTNIP00000007897 ENSTNIP00000007897

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]