SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007906 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007906
Domain Number 1 Region: 665-719
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000000000842
Family Tudor domain 0.00022
Further Details:      
 
Domain Number 2 Region: 273-331
Classification Level Classification E-value
Superfamily UBA-like 0.000000000034
Family UBA domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007906   Gene: ENSTNIG00000005230   Transcript: ENSTNIT00000008067
Sequence length 761
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:75645665:75652990:1 gene:ENSTNIG00000005230 transcript:ENSTNIT00000008067 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADLALSLEKEGWYLTEEAIAELKGSNEKITPNEIIRIVLDSDLRPIGRKFLPSDINSGK
TEELDGPCVLQLQKVRNISAPKDHAESQGAPRMLRLQMTDGHTTCVGLEYKHLSKISLNT
PPGTKVKLLGTIQVKNGFVLLDDSNISVLGGEVDHLVEKWEIQRSLAKHSRSNIGAEGGP
PPFVPFGQKCARNDDVDSRSLDQRKTLQTQIVAKSSEENKEFEKQRTAAIAEVAKTKEGP
RTFGGGGNAGGNLSGATSSSRSRDSHQQRKREERTERTERTESRQDGNYRELVDEGALRD
IMEMGFNKEAARQALMDNNNNLEVALNSLLTTSAGSRPCPAVAESNKPQSRARGKGRGRT
RNEDEENGAGGKPSGPSTLFDFLESKMGVLSIQESKSQGPQRHHDSKMNFSNSDHYPKDT
PLSRSAQGDYRQQRNDRPPRFYRDADFPKPGQEPPFNCTASSGPAQGQQGKGQERWARGT
SEKPQNDRRELLDGHIFPPSATTFPRSKDPQQQTELSGSHQQRPRNGDGGGNVTGPVHRK
GLKDGAPVSKLASVAGTESDGKGNNKRSDRTEERNSNRRKYDRQISDYPDRQKDSEDHRI
MPTEHTHLQNGDVEHKRTGPIKPLSAPIREPAPRKNPSNNPGFKKRSGPGKGPRGPDRGH
YVDHSWKPGDQCLALYWEDSKFYHARIDALHPSGSTAVVVFSDYGNCEEVLLHNIKPVTA
DMLEEEDEYYDSSLEFRRGGDGQPRRTRPTQQYYQPPRARD
Download sequence
Identical sequences H3CI28
99883.ENSTNIP00000007906 ENSTNIP00000007906 ENSTNIP00000002201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]