SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007923 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007923
Domain Number 1 Region: 9-119
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.37e-26
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 195-304
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 1.29e-19
Family Platelet-derived growth factor-like 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007923   Gene: ENSTNIG00000005245   Transcript: ENSTNIT00000008084
Sequence length 311
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:37779253:37804675:1 gene:ENSTNIG00000005245 transcript:ENSTNIT00000008084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEENISVTAAGGVIQSPRYPNAYPRDLVLSWKLLSPPGTRIHLEFDGQFGLEDAENGVCS
YDFVEVEDLSETSTIIWGRWCGHKAPPSLNSKANMLKVTFKSDDYFVAKPGFKVYYTMLC
PQYTKQTSPHRVPLTEVPLSLDDLDHHIAAFDTVEQLFKYLNPKTWKQDLDSIYTQTHIQ
LQHKVFILGNSHRPVDLNRLHDDVKRYSCTPRNYSVNLQKELRATNAIFFPRCLLVQRCG
GNCGCGTSNWNNSCACQAAKSALKLHEVLKYAPGTNLYQRHQRTQVRWVIAEILLTHHER
CECECVSQPPS
Download sequence
Identical sequences H3CI45
ENSTNIP00000007923

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]