SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007942 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007942
Domain Number 1 Region: 88-211
Classification Level Classification E-value
Superfamily Dystroglycan, domain 2 1.57e-56
Family Dystroglycan, domain 2 0.00000227
Further Details:      
 
Domain Number 2 Region: 379-478
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000188
Family Dystroglycan, N-terminal domain 0.016
Further Details:      
 
Domain Number 3 Region: 6-68
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000502
Family Dystroglycan, N-terminal domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007942   Gene: ENSTNIG00000005263   Transcript: ENSTNIT00000008103
Sequence length 774
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:76517866:76520454:-1 gene:ENSTNIG00000005263 transcript:ENSTNIT00000008103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALDPGGCLQVSETGKESLPGWLHWNASSGTLLGVPLEEDRGVHHISVSTYSDATSSSSEV
FSIEVHPEDVLEPDSSLRASADAQTFLCEGEEPVTVLTVIMDADLNKMSSGQRVALLDNM
RKFSGVDLQHMKMLPVVNNRLFDMSAFMAGPGNAKKVVENGVLLSWKLGCSLDQTTVPDI
SSIQGPAKAGTMSAKLGYPVVGWHVANKKQHLPKRVRRQLSNTPTPVLVVPPPTTVVEPP
VRIVPTLSSPSAAAPTETSAPPVRGPVPLPGKPTSRFREPVAHTPTLAPPQPTRVAETTS
TLPIQPTMTRPTYVEATATPPTPTPTPTSTSTSTRRTTKKPKRVKTTPAPKETKSSTAKP
SRRTTPSPALVPDPYNTKPELRNPIDQVSALVGTYFEVKIPSDTFFDRQDGTTDKLRLTL
RQNNNEVVGEGSWIQFNTTSQLLYGLPDAQHAGKHEYFMQATDKGGLNAVDAFEVRVDRW
PVNDKTPVVFTARFEGEPRALTNDIHKKILLVKKLAYALGDRNSSTVSLRNVTKGSVVVE
WTNTSLPQHPCPRDQLATMSQRLASPDGNPSPDFRFSMEPDFRPLDVKVRGKASCRTYSF
IPPGEVDSPEPAAVTPALGTGRQSTDDVYLHTVIPAVVVAAILLIAGVVAMICYRKKRKG
KLTLEDQATFIKKGVPIIFADELDDSKPPPSSTVPLILQEEKPPLPPPEYPNMAPPESTP
LNQEVLGTYTPLHDEDPNAPPYKPPPPFNTPLEGKGSRPKNMTPYRSPPPYVPP
Download sequence
Identical sequences H3CI64
ENSTNIP00000007942 ENSTNIP00000007942 99883.ENSTNIP00000007942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]