SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007965 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007965
Domain Number 1 Region: 202-589
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.36e-122
Family Ankyrin repeat 0.000000000432
Further Details:      
 
Domain Number 2 Region: 3-254
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.81e-74
Family Ankyrin repeat 0.0000196
Further Details:      
 
Domain Number 3 Region: 1217-1297
Classification Level Classification E-value
Superfamily DEATH domain 5.05e-24
Family DEATH domain, DD 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007965   Gene: ENSTNIG00000005286   Transcript: ENSTNIT00000008126
Sequence length 1297
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:76787285:76801417:1 gene:ENSTNIG00000005286 transcript:ENSTNIT00000008126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVGLLLDRSS
QIDAKTRDGLTPLHCAARSGHDASVELLLERGAPLLARTKNGLSALHMAAQGDHVDCVQH
LLRHQAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNR
VKVMELLVRYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQSGASPDVSNIRGETALHM
AARAGQVEVVTLLRNGAMVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGY
TPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVASKYGSLEVAQLLLRRGAPPDC
AGKNGLTPLHVAAHYDNQRVALLLLDKGASPHAAAKNGYTPLHIAAKKHQVEVAVALLQH
GAATDVLTVQGVAPLHLVAQEGHADLAALLLGDGARVDLQTKSGLTPLHLAAQEDRVGVA
EVLARSGADLDQQTRLGYTPLIVACHYGNAKMVNFLLQKGAVVNAKTKSGYTPLHQAAQQ
GNTHVINLLLQHGAKPNAMTLNGNTALGIARRLGYISVVDTLRVVTEETVVTTTTVTEKH
KLNVPETMSEVLDVSDEEGDDTVTGDGGEYLRAEDLRELGDDSLPGQYLDGMNYLRFSLD
RSFTPTHACWSPRRSGGVDEGTLSSQQALALARDKDRDADLLSWTKEDLDNVALSSSALH
SGFLVSFMVDARGGAMRGCRHNGLRIIIPPKTCSAPTRVTCRLVKRHRLATMPPLVEGEG
VASRLVEVGPSGAQFLGPVIVEVPHFAALRGRQRELVVLRTQSGDSWKEHQCEHTQQELN
LVLNGLDEGLDTPEELDRKRVCRIITRDFPEYFAVVSRVKQDSHLIGPEGGVLSSTVVPQ
VQAVFPEGALTKRIRVGLQAQPVGVDVVRKLLGNKATFSPIVTLEPRRRKFHKPITMTLP
VPPSSQDALFPGFGGDTPTLRLLCSITGGTTPAQWEDITGTTPLTFADDCVSFTTNVSAR
FWLVDCRQTQESVGFSSQVYREVICVPYMARFLVFAKTQDPVEARLRCFCVTDDKADKTL
EQQENFSEVARSRDVEVLEGKPIYADCLGNLVPLTKSGQHHLFSFFAFKENRLALFIKVR
DNSQEPCGRLSFMKEPRNYRCLSQSAICNLNITLPPYNRVQRRDRQVDFARISVRPCAHD
CLVVFAVDPQDEAERKEQHLAVIAEHLGFSWTELARQLDFGDDKINLIRNENPNSLQDQS
HALLKLWAETEGEHGTEAALIKRLTKINRMDIVHLIE
Download sequence
Identical sequences H3CI87
99883.ENSTNIP00000007965 ENSTNIP00000007965 ENSTNIP00000007965

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]