SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007968 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007968
Domain Number 1 Region: 2026-2190
Classification Level Classification E-value
Superfamily C-type lectin-like 8.92e-30
Family C-type lectin domain 0.00069
Further Details:      
 
Domain Number 2 Region: 1740-1851
Classification Level Classification E-value
Superfamily CalX-like 1.44e-20
Family CalX-beta domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007968   Gene: ENSTNIG00000005289   Transcript: ENSTNIT00000008129
Sequence length 2192
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:76833662:76843169:-1 gene:ENSTNIG00000005289 transcript:ENSTNIT00000008129 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCLWTLVPAVLLGLSSSQASLLKVNKGLKVKRGQAAFLQEDHLQFRVPPQRDACKVEVLQ
NQPVSQRVGKLLPQVFDCHFRSDEVKYVHNGCPLLLEDTVLLRLYRFTETETHTEVFSIH
VDIVQPDCGLIKLGPKSLKVPEVYGLSDALDANVVSFHYERRSSLQCSVLLSRQDTHFPA
HGQLVTGEPQEATKRGDEPESLVPLRQQLDNQARARCRSEDCLKGLKLARFSKVPCDQFL
MMGLRYQHTDPPSPDKDYVTIKLELRDLRSGGVYRSEQAWIPVQIGGALPNQPPKASFMS
MLILEVDQFILTPLSTATVDAEDEETPQQLLVFNITKPPADGFMAHLSDHTQPVSSFTWL
DLNDMLVAYQPPNSSHSQRRNCEVELEVHDLFFERSPPVTVHMSVRSADTNAPRVSWNMG
LSLLEGQSRPITWEQLQIVDNDNLDAVRLVVVDGLQHGRLTIRGAKGFVFTVSDVKAGVV
RYHHDDSDTTKDYVVFRISDGQHQTRHKFPIKVLPKDDSPPFLTTNMLLEVSEGQTVLLG
ASTLQASDMDSSDDYILYNVTRAPRAGQILKVPGPGVTGYPVSQFLQRDLFRSTIYYRHL
GNEVFDDSFEVVLSDVHEPPNFSEPQVVTVHIQPVPDQPPKEAPGSSRCLVVKETDVVLI
TRDQLQFVDEESPDSELIYTVTSPPFYRDPHGRSSDAGRLFLVDSIPKFTKDPAAPVLRL
FTQHAVNFLKVAYMPPAVDIGPNPQHVGLVLSVTNHQGRSVTGICFNITVMPVDNQPPQV
VAGVLMVDEGGESPVGSQNLLLSDVDSREEALQVHLQAAPRHGALRIGNVPLEPGHFFTV
KDLRSLQMRYRHDGSETPEDLIEFTATDGSNSVPFVLEVKVNPINDEVPVLAPGLKPVLR
CPEGQETLITTEFLCATDADSADGSLLFLVARQPRHGVVLCRGRVVDRFVQAEVTAGTVS
YRHTGREVGLTPCHDTVTIVVSDEGAEGGGSWAEPRDSLPVYDLRVTVLPVDNQPPSLTA
GEIFSVDEGGVAPITTSHLRASDEDTPLDQLVVSLIHPPQFGYIENVLPSPGFEKSNTGI
SIASFSYRDIVDGHVNYVQSRHQRVEPTADQFKLCVSDGGRASAHLPFHVVIKATNDEIP
EFVAHNITVEEGDRKQLDLSVLRALDLDVPEDELRFSLFRAPRHGSIIRGADRRNSTGTP
GGGRPSRPGTGRPRRPEPVLDFTLQDLQNGMDVTYVHDDSDTTEDSFVLRLTDGRHELDR
EVAVRVVPVNDQEPRLVRNSGVEVEPGEARLISSAALLAQDADTPATEVRYRIQSVPTQG
LLQLKESRDWVTLEAGADCSQEQVSMNRLRYLHMGADGAKAQDFFVFRLLDGQNQSPPQH
FHISVKELEKGSISVFVKPAKVSRGDRVTLTTDVLLATDGSGKPEELLYVVTGPPSHGHL
EYVAHPGAAISAFSQLDVAANQVAYAHDNRAGSPRECFQFVVSNGQTSRNGSVEISVEAV
DRILPSLSANRGLRVPQGTTVLLGPDRLALSDPDTPAEALTFALSQPPQYGKLLLAGSAL
TSGSSFTQKNIQEVEVAYQHDGGPSQIDRFGFTASDSTARGFLLDGRLQTEPVFFTVQIQ
PLDQRAPDVLKLLPLWKAEPLGDGRHGIFLSSRELKAQDAGGGTDEQLMFRVTRQPYFGY
LENITTGGFVPRRFSQLELNKRTIVYVIDPDKPSLSDSLEFQVSDALGNTGPSHRLEFRW
SSVELSLPSYFVCEEQGAVSLDIIRKGNLAESSYVTVKAEEVTATAGRDYLLSPSSLVQF
DPGVSRRSWQIQILQDELEEAAEMFEVLLTSPEGAVIGGIGRAQVTIGRSGSRTGGGDAS
GGCRLNQSHHAHHAPVLGGREIPLDVYPQHGSIKLEKLPLGTDSLLYTRGDSIPRPSEGA
TGNQVRVTSNNPQVVRPSSVFHNGTAVVLTYHGMVQMQVEDDTSPSRKGRKANVRVRPAP
VVGPELGVGLASELRRRTFKPGSTKGRARMEEPQEVAESSTPKPCSPDLRGLLHLNQSTN
QIVHCNGVSWKRWTPTDQMASALTCPRGWTFHGGRCYILNTEKKVTWSQANRTCRERYQG
TLSSVLSKADMDWLWDFGRRRPFWIGLNDREGRGRWRWAGGEPLVYTNWRRTPSRWGTKG
RDKCVLVWRRAEWRSRDCKSARGRGFVCWRKP
Download sequence
Identical sequences H3CI90
ENSTNIP00000007968 99883.ENSTNIP00000007968 ENSTNIP00000007968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]