SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008055 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008055
Domain Number 1 Region: 61-195
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.78e-23
Family Laminin G-like module 0.0000826
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008055   Gene: ENSTNIG00000005372   Transcript: ENSTNIT00000008218
Sequence length 270
Comment pep:known_by_projection chromosome:TETRAODON8:20:535393:537022:-1 gene:ENSTNIG00000005372 transcript:ENSTNIT00000008218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALWKAVAGVLLAALGLALLGRPAEAQGNGRDKKQVSGDSAMFLGQEREAWRPLVATTV
NLSDINSIKSSFQLQTFDPEGVIFYGDTKGGADWFVLSLKDGVPLMQIYRAGIYVSVAGG
TKLSDGKWHTLEVSNQGDFVILEMDGSDKLVVGMHPAEPEKVLAGELRLALGGVLINPEL
MVVPVGPRFDACLRQGSWLNLSTPWETDAEELWPCYQRLEPGSYFSGAGFAIFNISVFHI
DAHRGMKVELFGDFSKMDGTILSIKAPGQE
Download sequence
Identical sequences H3CIH7
ENSTNIP00000008055 ENSTNIP00000008055 99883.ENSTNIP00000008055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]