SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008059 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008059
Domain Number 1 Region: 63-230
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000103
Family SPRY domain 0.069
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008059
Domain Number - Region: 686-841
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000459
Family Clostridium neurotoxins, the second last domain 0.088
Further Details:      
 
Domain Number - Region: 275-434
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0103
Family SPRY domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008059   Gene: ENSTNIG00000005376   Transcript: ENSTNIT00000008222
Sequence length 1111
Comment pep:known_by_projection chromosome:TETRAODON8:20:504109:508990:-1 gene:ENSTNIG00000005376 transcript:ENSTNIT00000008222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAAAQTPGVVYGVVDLYGMAVKVTIVHNHNHSDRLRRNNAIMRALSPDVGRPRPSLSLTP
DAEAPDRLLFHTNCGQKAAIISDGRTALRPHATDDFNHGVVLSNRPLRSNEVFQVRIDKM
VDKWAGSIEIGVTTHNPAYLQLPSTMTNLRSGTWMMTGNGVMHNGTTILDEYGHNLDRLK
AGDTVGVVRKEDGSLHFFVNGVAQGPAAWNVPPSVYAVVDLYGQAAQATIMDDMVDLPPL
PEDSSDGPAVLSPGSPCSVGGATTNDLRFHQLHGTNAVITNGGRTALRQNCRSEFNDAIV
ISNRCLRDGELFEIVIQKMVDRWSGSIEAGVTAIRPDELEFPNTMTDIDYDTWMLSGTAI
MQDGNTMRNNYGCDLDSLTTGSRIGMMRSAGGDLHYYINGADQGVACSGLPPGRGEVYAV
IDLYGQCVQVSITSSSGPLDNSLCTSNVTEKSFPIQSPGVVAGVAHRLHSKHGKNVVLLG
EGCQAVRVGGYSHGIVFSAKELKTDELFEVRIDEVDEQWCGSLHVGLSTLAPPELPSCPL
SGLSPSLPQLRSKVTWLLCGSEVQRNGALQRQNYCCSLERLKVGNRVGVKRCSDDTMHIF
IDGEDMGSAATAVAKNVYAVLDLYGRITAVSIVSSSLTEDVESLKAPSLSSGSCSEGEEE
GTPVREGLQEEPEPCALLPTLVTFLENHGKNIQLSNQNLTAARVSSYNQGLLVTAQPLAR
QQLFQVRIDRLNPSWTSSLSLGVIGHSPDRLNFPSTACGLKRSAWLLQRDSVFHNSLKIC
ENYGPNLDTCPEGTVLGLLVDTSSCLHLYVNGMDQGVAAQDVPSPCYPFIDLYGQCEQVT
IATNHLPAVGGDGGEARCQGDMEKADMVDGIKESVCWTPPPEVNPNKVCEYQLCARFKDL
LTLPDGYFNEDAKYNLCYCESCYKLRGDEAYYKRGEPPRDYALPFGWCRFALRLKPHCEV
STALKKWHIAYHGTGVGTLRRTLDHSQLLPGTSSVFSVSPVKTEGPNDYGEPEENSAPGR
EVPRVRLSPTMRYSGMETFAPKVKFQDPRSRRCHQAQVAFQVCIRPGSYKVGAQSVGHSE
TLDPRFSNAEIEWITKEQGGTLLYGLLIRVE
Download sequence
Identical sequences H3CII1
ENSTNIP00000008059 ENSTNIP00000008059 99883.ENSTNIP00000008059

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]