SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008060 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008060
Domain Number 1 Region: 1120-1447
Classification Level Classification E-value
Superfamily NHL repeat 2.12e-22
Family NHL repeat 0.0051
Further Details:      
 
Domain Number 2 Region: 1353-1394,1421-1440,1468-1544,1576-1601
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000000118
Family All0351-like 0.082
Further Details:      
 
Domain Number 3 Region: 808-882
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000116
Family Pre-dockerin domain 0.068
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008060
Domain Number - Region: 645-671
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000142
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 544-569
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000174
Family EGF-type module 0.044
Further Details:      
 
Domain Number - Region: 511-536
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000342
Family Integrin beta EGF-like domains 0.058
Further Details:      
 
Domain Number - Region: 679-717
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000599
Family EGF-type module 0.046
Further Details:      
 
Domain Number - Region: 615-640
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0018
Family Integrin beta EGF-like domains 0.087
Further Details:      
 
Domain Number - Region: 477-504
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00535
Family Integrin beta EGF-like domains 0.044
Further Details:      
 
Domain Number - Region: 447-471
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0419
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008060   Gene: ENSTNIG00000005377   Transcript: ENSTNIT00000008223
Sequence length 2648
Comment pep:known_by_projection chromosome:TETRAODON8:18:3046249:3094665:-1 gene:ENSTNIG00000005377 transcript:ENSTNIT00000008223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQHFSLRHLGIYEPPPQRGLTFCSDLGVSHRGFSVGAVQDLDDDGQAATSPEHGRRLWCR
GDLGKSSERSSCLSSRSNSLLTLTDTEHENKSDSENEIPSHNPPRPVLSPVNPHKKKQAE
MHHPSYSQSLNSAQQLPPATGSPASLAGQLPVEVQTTPPDSVPLQDSWVLGSNVPLETRH
FLFKTGTGTTPLFSTATPGYTMATGSVYSPPTRPLPRNTLSRSTFKFKKSSKYCSWRCMA
VSAVGLSVLLALLLCYCIAMHLFGLNWQLQDHETFGLFENGGGARDTTPNTFMVSTDNSK
WVLLENNTIDTGEVDVGRRAMQVIPPGVFWRSQLYIDQPLFLKFNISLEKDALVGVYGRK
GLPPSHTQYDFVSLLDSNRLMSKEKRALSDADLRARHTRSVSTHEASFVQYLDTGIWHLA
FYNDGRNTEQVTYSTVIIESIMECPQNCHGNGDCLSGICHCFPGFLGTDCSRAACPVLCN
GNGQYSHGRCQCYSGWKGVECDVPANQCIDIHCGGHGICLMGACSCNTGYKGDNCQEVDC
IDPFCSSHGLCIHGECHCQPGWGGANCEIAKAVCPDQCSGHGTYNTDTSTCTCNQNWTGL
DCSIGLPHTEQCEVDCGSHGICYSGVCRCEEGWTGTLCEQKACHPLCSKNGVCKEGKCEC
DQGWTGEHCNIAHSPDIRVKEGCPGFCNNNGRCTLEASGWHCICQPGWRGAGCHVAMETL
CTDGKDNEGDGLVDCLDPDCCLQLSCQNHLYCKGSPDPVEVLSQSPSSLDPQQAARSFYQ
RIHFLVGPESTHVVTGDSPFNKSLVSIIRGQVLTADGTPLIGVNVTFVDYPDHGYTITRE
DGMFDLLTNGGASLTLSFERAPFLNQYRTVWVPWNVFYVMDTLVMKKEGNDIPSCDLSGF
IRPSPVIVASLVSKFYRSAANGPIIPETQVLQEEISIPGSDLKMIYLSSRAPGYKPVLKV
SMTQSSVPFNLMKVHLMVAVVGRLFQKWFPAQPNLSYTYIWDKTDAYGQRVYGLSEAVVV
SVGFEYESCLDLILWEKRTATLQGFELDASNMGGWSLNKHHILDVQNGILYKGDGENTFI
SQQPHVIKSIMGNGRRRSISCPSCNGQAEGNKLLAPLALACGDGSVFVGDFNYIRRIFPS
GNVTSVMELRNKDFRHSNNPAHRYFLTTDPVTGRLYVSDTNSRRIYRPLLLSGVRDLMGN
GEVVAGTGEQCPPFDEARCGDGRKATEAQLLGPKGGIAADRNGLIYFVDGTMIRKVDLNG
IISTVLGSHDLTSARPLTCDTSMHVRQVRLEWPTDLAINPMDNSIYVLDNNVVLQITENG
QVRIVAGRPIHCQVPGIEYTVGNRAVQTMLEGATAIALSYSGTLYIAETDEKKVHRIRQV
STDGEMILIAGAPSECDCKNDANCDCYQSETGYAKDARLNCPSSLAVSPDGTLYFADLGN
IRIRAIQQNRQSAENCLGSYEVACPTSQELYIFDANGTHQFTASLITGDYMYNFSYSNEE
DVTAVTDSNGNTLRIRRDTNRMPVRVVAPDNQVIWLTIGTNGHLKSLAAQGQELLISYHG
NSGLMATKSIQIGWTTFYDYDSEGRLTNVTFPTGVVTSLHNDMSSGAVAVDIETSGRDED
VSITTNLSSVDSFYTLVQEQLRNSYQVGNDHSLRVTYANGMVTHYQTEPHILAGAANPTV
VRRNMTLPGENGQNLVEWRFRKEQERGKTVVFGRKLRVNGRNLLSVDYDRSLHTEKIYDD
HRKFQLKIIYDAQGHPTLWDPSSKLLSVNLTYSSTGQVTGLQRGQSTEKWEYDNQGRIIS
RVFADGKTWSYTYLDKSMVLMLHSQHQYIFDYDAGGRLAALTMPSVARHTMQTIRSIGYY
RNIYTPPESNASVTVDYSEDGQLLRVAHLGTGRQILYKYRRQNKLAEILYDSTRVSFTYD
ETAGVLKTVNLQSEGFICTIRYRQVGPLVDRQIFRFSEDGMVNARFDYTYDNSFRVTSMQ
AVINETPLPIDLYQFDDISGKMEQFGKFGVIYYDINQIISTAVMTYTKHFDQDGRIKEIQ
YEIFRSLMYWITIQYDSVGRVIKREVKIGPFANTTKYGYEYDVDGQLQTVSLNEKIMWRY
NYDLNGNLHLLNPGNSGRLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGADIFEYNSKG
LLVRVYSKASSWTVQYRYDGLGRRVASKNSLGQHLQFFYADLSYPTRITHVYNHSSSEIT
SFYYDFQGHVFAMELSSGDEFYIACDNTGTPLAVFSNNGLLLKQVMYTAYGEVYFDSNPD
FVLVIGFHGGLYDPLTRLLHFGEKDYDISAGRWTTPDISIWTRVAKDPQPFNLYMFRGNN
PISKVHQIKDYVTDVNIWLVTFGFHLHNAIPGFPVPKSDLTEPSLEMRKSQLWDDLPSVT
GVQQEVMRLSHSFLSFERMPEIQLHHRRSDQDKTWLWFSTVRSLIGKGVMLAVTQGRVVT
NALNIANEDCIKVAAVLNNAFYLEELHYTVEGRDTHYFIKTSLPENDLSALRLTSGRKSL
ENGVNVTVYQSTAVINGQTRRFADVELQYGALALHVRYGTTLDEEKARILELARQRALSN
AWAREQQRVRDGEEGVRLWTEGEKRQLLSGGKVLGYDGYYILSVEQYPELADNANNIQFL
RQSEIGRR
Download sequence
Identical sequences H3CII2
ENSTNIP00000008060 ENSTNIP00000008060 99883.ENSTNIP00000008060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]