SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008069 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008069
Domain Number 1 Region: 58-520
Classification Level Classification E-value
Superfamily Sema domain 1.15e-141
Family Sema domain 0.000000176
Further Details:      
 
Domain Number 2 Region: 516-560
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000262
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008069   Gene: ENSTNIG00000005386   Transcript: ENSTNIT00000008232
Sequence length 772
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:15984938:15990517:1 gene:ENSTNIG00000005386 transcript:ENSTNIT00000008232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPWRPPLLWLLLSWRLLSATASTLFPRDLEPISVVGPEQSRLFPGFQGLLQDNDTRRLGL
DFQRMLRIKHMLYIAARSDHVFAVNLTTASDRFAPQLKLTWRSKDVNKCTVRGKKSDECY
NYVKVLVPRDDETLFACGTNAFNPTCRTYQMASLQQVGEELVGQARCPFESGQTNVGLFA
GGDFYSATMTDFLASDAVIYRSLGDERPVLRTVKYDSKWLREPHFLHAIDYGNYVYFFLR
EMAVEYTTLGKVVFSRVARVCKNDNGGSPRVLERYWTSFLKARLNCSVPGDSFFYFDVLQ
SLTNVLQVNQRPAVVGVFTTQANSIPGSAVCVFYMDDVEQVFTGRFKEQRSSDLSWTPVP
EEQVPRPRPGTCAGEGPAADYKSSVQFPDEMLGFIKSYPLMDEAVPAVNHRPVFTRTTNR
SKLTQIAVDVSAGPTKDRTVMFLGSEDGRILKLVASMRPNASVGAELLEDIYVYDPSRCD
AQGQQDRRVLALELDKDHHALFVAFSSCVLRVPLSRCARHGACRRACLTSADPYCVWLRS
GRCANVVPGFRAEFDQDTEDGGALDACVTPASAGNQEAAAGSAHELDQRVAAHVHYTLLI
ACVLVAFFLGAILSGFLVSCYCGRSAAQRARRLGKDPEASLSHALSLRSLAKLNGLLDTR
SKQEDRGDVSKLYSSFIPNGHSEPHPVAQADGELSGLPTPDSTPNLSGRRSEQRQPCESN
QSCSNDKKASGTDGAAEGGGGAPQQRPLPQQRLLPQAVVDVSALDDLLQHIH
Download sequence
Identical sequences H3CIJ1
ENSTNIP00000008069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]