SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008096 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008096
Domain Number 1 Region: 18-223
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.46e-58
Family Ankyrin repeat 0.0000993
Further Details:      
 
Domain Number 2 Region: 239-279
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000144
Family SOCS box-like 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008096   Gene: ENSTNIG00000005410   Transcript: ENSTNIT00000008259
Sequence length 280
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:8717469:8719749:-1 gene:ENSTNIG00000005410 transcript:ENSTNIT00000008259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIENSCPYFFGDIGCWAERTDVHKAASQGQTTLLQHLIQSGASVNVVAVDSITPLHEAC
VRGQVECVRLLLEAGAQVDARNVDGSTPLCDACSAGSLECVRLLLEHGAKANPALTSRTA
SPLHEACIGGNADCVKLLIAVDARLEAYDLYNGTPLHVACANDYVDCVKVLLNAGAKVNA
ARLHETPLHHAAKNMRVEMIEILVEFGANVYARDQHNRKPVDYTTPGSPSAGCLSFYESV
PMSLQQLCRLALRKELGTRALKVIGQLHIPKLLISYLSYQ
Download sequence
Identical sequences H3CIL8
ENSTNIP00000008096 99883.ENSTNIP00000008096 ENSTNIP00000008096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]