SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008105 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008105
Domain Number 1 Region: 2145-2437
Classification Level Classification E-value
Superfamily BEACH domain 4.19e-118
Family BEACH domain 0.000000000111
Further Details:      
 
Domain Number 2 Region: 162-341
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.71e-30
Family Clostridium neurotoxins, the second last domain 0.023
Further Details:      
 
Domain Number 3 Region: 2034-2140
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-26
Family PreBEACH PH-like domain 0.00000522
Further Details:      
 
Domain Number 4 Region: 2548-2726
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.93e-17
Family WD40-repeat 0.0028
Further Details:      
 
Domain Number 5 Region: 469-523,619-914
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000000633
Family Plakophilin 1 helical region 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008105   Gene: ENSTNIG00000005417   Transcript: ENSTNIT00000008269
Sequence length 2748
Comment pep:known_by_projection chromosome:TETRAODON8:18:8160420:8276690:-1 gene:ENSTNIG00000005417 transcript:ENSTNIT00000008269 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAMALNPGIPIRGIKMKFAVLAGLVEVGEVSNRDIVETAFNLLVGGQFDLEMNFIIQEPE
SIGCMVELLDKCEPTCQAEVWSIFTAILKKSVRNLQACTDVGLIQQVLDRITTTDSMIAD
LLVDMLGVLASYSITVKELKIFFSKLQGEQGQWPRHAVKLLSVLRYMAQRTGPDSFFSFT
GKNAAAIALPPIAKWPYQNGFTFHTWLRMDPLNNINVDKDKPYLYCFRTSKGLGYSAHFV
GGCLIVTSLKSKGKGFQHCVKYDFKPQKWYMVTLVHVYNRWKNSEISCYVNGELASFGDI
AWFVNTSDTFDKCFLGSSETADTNRVFCGQMGAVYLFGEALSAAQILAIYQLGPGYQGTF
KYKAESDLLFAEHHKTLLYDGKLSSSIAFTYNPRATDAQLCLESSPKDNASIFVHSPHAL
MLQDVKAVVTHSVQSGIHSIGGVQVLFPLFAQLDYRQPSSHELDTSVCCTLLSFVMELLK
NSVAMQEQVLACKGFLVIGHTLEKSSKVHVTRSVLDIVLAFSRYLSNLHNGIMLLKQLCD
HILFNPAVWIHAPAKVQLMLYTYLATEFISTVTIYNTIRRVSTVLQVMHTLKYYYWVVNP
QDRSGVLPKGLDGPRPNQKEILSLRAFLLLFVKQLIMKDHGVKDDELQSILNYLLTMHED
DNLMDVLQLLVALMSEHPGSMIQAFDQRNGICVIFKLLASKSEGIRVQGAESNGRYFLKH
MPAKRKSEVMLSSGLFSLLTERLMLHSSQCTMTTYNVLFEILTEQICTQVIHKQHPDPDS
TVKILNPQILKVIAILLKNSAQSPETMEVRRVFLSDMIKLFNNSRENRRSLLQCSVWQEW
MLSLCFINPRNSEEQKITEMVYAVFRILLYHAIKFEWGGWRVWVDTLSITHSKVTFEQHK
ENLSRMFRQYQHQDSGSVRTISGVSQSMEQMDSVNGSPTEESAPSTVIELTVDSPSGPTE
PSGEAEPASVTVSNILRGAGEGEQKLGEEANVTVTQASEKQGEGPDDGNAEDTTTEVLLT
EDDAERGPSSAKEGSTNEDSELPSESASCLESSALGGASVFSEDLVDVSSVSDQAQPSDA
DDSQEESSSIPGPAGEEEEEEIQHEQEKGEEMKDEKQKIGTEETTKASETRVEQDVTETP
KDADNLEQSSTVTPTTPADTTTPPTAQEAPAPSASTSDRQPSGAAATAEEPATSEHGSTA
ASSSGKTKEIRIARLDVSNVASDTERLKLKETVEIEPHMRRRRKPANWHQQQRQRQKAEE
ELQEVRGPRSTMFRIPEFRWSHMHQRLLTDLLFSIETEIQMWRSHSTKTILDFVNSSENV
VFVHNSIHLISQVVDNLIMACGGILPLLSAATSSTHELENIEPSQGLTVEASVTFLQRLI
NLVDVLIFASSLNFAEIETEKNMSSGGILRQCLRLVGAMAVRNCLECQQAQFKQGKEATA
HTYTALPANALGISKSASAQSPVDAVTGGMSPVRDLDRLLQDMDINRLRAVVFRDIEDSK
QAQFLALAVVYFISVLMVSKYRDILEPHNDKKHPQRSQSARSTGTQAQIPKNSRNLDQMM
SPDSGAVSGEAENGVSIRRYDSGIGDEHTSTAASEGDLSSTGVTHGPDAISEALSTLSSE
VRPSLPADSKGKNVKDILRSLVSPPSDDVTVDPNLLPPSFLGNMGDMTRESFRSFDRSVI
VAPKKSGLAPSISASAAFPAATAASVSSGTPMDSVAVVSAGDASQSTSAEAAAAGGQVPA
SASLPSVPPLSPVTQNTAPNMSISERLEHALEKAAPLLREIFVDFAPFLSRTLLGSHGQE
LLIEGTSLVCMKTSSSVVELVMLLCSQEWQNSIQKNAGLAFIELVNEGRLLSHTMKDHLV
RVANEAEFILSRQRTEDVHKHAEFESTCAQYTADKREEERMCDHLIRAAKYRDHVTAMQL
IQKIVNILTDKHGAWGSIPTSSRPREFWRLDYWEDDLRRRRRFTRNPFGSTHSEATLKAA
AEHVSEEDILKGKQPIRGQALGNPSSESETLLDGEDDTLSSLDEKDLDNLTGPVSLSTSA
QLVAPAAVLKGTLSVTASELYFEVDEDDPGFKAIDPKILAYTEGLHGKWLFTEIRAIFSR
RYLLQNTAVEIFMANRMAVMFNFPDAATVKKVVHSLPRVGVGTNFGLPQTRRISLATPKQ
LFKAANMTQRWQRREITNFEYLIFVNTIAGRTYNDLNQYPVFPWVITNYDSDELDLTLPS
NFRDLSKPIGALNPKRAAFFSDRFESWEDDQVPKFHYGTHYSTSSFTLMWLLRILLPITT
NDHADRTFSSVSRAWRNCQRDTSDVKELIPEFYYLPEMFVNANSYSLGVMEDGTVVSDVE
LPPWAKSPEEFVRINRLALESEFVSCQLHQWIDLIFGYKQQGPEATRALNVFYYLTYEGA
VNLNAIGDPMLREAVESQVRSFGQTPCQLLIEPHPPRSSAMQVTPLMFTEQMQQDVIMVL
KFPSNSPVTHVAANTQPGLTVPAIITVTANRLFAVNKWHGLTGHQSSVAQDQQYQLPVEI
DPLIANNVGSHRRQISDLLDQSIQISSQCFVITADNRFILLCGFWDKSFRVYSTDSGKLT
QIVFGHRDVVSCLARSESYIGGDCYILSGSRDATLLLWYWNGKYNSIGESPGREFTTPRA
ILTGHDCEVTCASVCAELGLVISGCKEGPCLIHSMNGDLLRTLEAPEGCLHPRLIQSSTE
GNCIVYYEKGHFCLFSVNGKLLGHVEVEDSIKAAAPRLQLYLVLSWTY
Download sequence
Identical sequences H3CIM7
ENSTNIP00000008105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]