SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008163 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008163
Domain Number 1 Region: 1049-1129
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000165
Family E-set domains of sugar-utilizing enzymes 0.014
Further Details:      
 
Domain Number 2 Region: 1721-1797
Classification Level Classification E-value
Superfamily E set domains 0.00000000000014
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.087
Further Details:      
 
Domain Number 3 Region: 960-1034
Classification Level Classification E-value
Superfamily E set domains 0.0000000000028
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 
Domain Number 4 Region: 215-303
Classification Level Classification E-value
Superfamily E set domains 0.000000000331
Family E-set domains of sugar-utilizing enzymes 0.03
Further Details:      
 
Domain Number 5 Region: 1229-1288
Classification Level Classification E-value
Superfamily E set domains 0.000000000364
Family E-set domains of sugar-utilizing enzymes 0.04
Further Details:      
 
Domain Number 6 Region: 1636-1711
Classification Level Classification E-value
Superfamily E set domains 0.000000000501
Family E-set domains of sugar-utilizing enzymes 0.018
Further Details:      
 
Domain Number 7 Region: 317-444
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.000000000772
Family Anthrax protective antigen 0.035
Further Details:      
 
Domain Number 8 Region: 1550-1627
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family Other IPT/TIG domains 0.034
Further Details:      
 
Domain Number 9 Region: 1455-1531
Classification Level Classification E-value
Superfamily E set domains 0.0000000021
Family E-set domains of sugar-utilizing enzymes 0.049
Further Details:      
 
Domain Number 10 Region: 1297-1394
Classification Level Classification E-value
Superfamily Cupredoxins 0.00000156
Family Plastocyanin/azurin-like 0.061
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008163
Domain Number - Region: 86-135
Classification Level Classification E-value
Superfamily E set domains 0.028
Family E-set domains of sugar-utilizing enzymes 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008163   Gene: ENSTNIG00000005470   Transcript: ENSTNIT00000008329
Sequence length 1833
Comment pep:known_by_projection chromosome:TETRAODON8:21:640980:655352:1 gene:ENSTNIG00000005470 transcript:ENSTNIT00000008329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFAQERQFQLNPTDDSFGNRVTFVSSTLSFPCDVERDSTHGGQILCYTRAMPSEYYGLHV
TVDGVPTVVCNGNHFHPYCRFYTVNYRTPTINTVSPITGPPGSVFTIRGRIYTDVYGSNT
KLSSNGRDVRFLRSYIGGMPCDLLKPQSDELYQLQLDNENSVWGYMSCKMAGTYVGHHNL
SYILDDEYGRSLPDKPLYWVSGVGKLAMIQTYAEVTGVSPSKGSVEGGTLLTVDGRFFDQ
TDQPARVFVGGLPCEIENVSDDRITCRTAKQDPASKKTVYPGGRGLKIEAWNDTRSNQLS
DVFSFNESRPGYWTEWTDILPKIFLFDFQYFSTRSRGFFVPPESGNYMLYIHCDDRCELY
LSNSSLPEHKVKIAYQPRYTGSMFSFESQRSELMALEGGEYYYLEILHQEFWGAASFNVG
LFSEKSSFTETQTDDAVNEVQDIVAQYDVFDDEYVIIFTSMPQNTVTINEVQVVTVKSNC
SSQLCGSTFYRLGYEAAMTGPIPVSASAAMVEAALNSLWSIKPDTVRVTKQDDSQGSHYT
VTFSSDRGIKGCVHLLLLLQQLVHVSYLIQAKSKGCFDLKYFTCHGSVFNYCVERMFVQR
KSQRLSRLEEQFLKLPCVLQYCCCKYHSTKQFNVTVTDFWIKTEKPLASVYFAIKVDVFL
NFILSDNKCLQKSQHRQTLYYNKYYCCTILFYLHSRFSTAVMIWLSTWMERRLSISHASA
GLLHLCRAPSMWRSLEAGPKVVTTHKLPSKLALCYCDSKLSKNDAHYFTQNVSLDKFPTY
FEYCCSITVILNNIYLLCCRVILKCLRFEIIFRTLSLSLCVIYSVLQVFGDKKLTLFHRD
EWLSVGINEEDLKYALEGIEGMGQLSVQWQGTCRSPKWRVEWLSKPGDQPLIQVNDSSVF
GGTNIVVSAEEKKKGGLLMRSIAGDLLRVCESKPQVEVLINGIPSKCSGDCAFEWSEDRT
PVVTEINPSQGSIGLGTLLTVTGTGFISENASILVGTAKCHVEQITNTTQVCRLGSATAG
TYPVTVSFPSLGHSRYAEGNVFNFTYQLIITSFSPSSGSIADIGGTLLTVGGFGFSENAT
VTIGSNECKVVHATDTELKCRTPAGTAGSQTITVTVSKMSQAASSSFTYDAGLTPQISGL
SPSTTTVTGELSLKEMKRLKEKYATCSTSCLIGRSSCDFSDTPFSNVFACTSLVVIPACR
HLLEIQALQTHIVSHSNSVNATIEYILEVHSVSPLYGSLMGGTRLTLSGSGFSNNISDNR
VFFGDAECEVKDASENELQCILQTEQKTHIVTNQGSHYIYGQGYAWSTPSLTISVGDTVK
WSWEAPPFLNTGYRVFSVSTPSGTTYEGGPFNSGDTKTAKGSFMYRFTIPGVYYYSSGYL
DDSNVKIMQGVVKVQPLVDKSNRIVVYVGGIEAKHVTGGEWSHRVSRATSGCVALPQCLQ
SNSISDPFSFTASTCSTPTVHAISPNQGSYHQILHIQGNGFGNTTCAIEVIVGGQPCEVI
NSTNADIMCRLRYDNRLPIGVAHAVVVRIANLGDAVIAIADELSRRFVLLPAVDSLAPSI
GSPTGHTRLHIKGSGFPEGHVTVASEWCAIVSVNYTSVICDTSPSQPHGGDVIFQIGNIQ
SSCHSNCEYMYSSSVTPALTTIAPNNISETTDVVIYGSGFGNHADDVVVFASNTELRITN
VNDGNISARVDALPAGDHPIKVIVRSKGLASGILTLSSLPVASLSPLEGSLAGGTSLTFT
GNGFAPGNTSVLIGGQPCEIRHVTPSTLHCITPPHVEGQVRTDIWVLSTQYPPLTFNYSA
TQTPVLSSITPITGVPILICFALFFFFMLFRQF
Download sequence
Identical sequences H3CIT5
ENSTNIP00000008163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]