SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008168 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008168
Domain Number 1 Region: 2-164
Classification Level Classification E-value
Superfamily UBC-like 3.17e-50
Family UBC-related 0.000000322
Further Details:      
 
Domain Number 2 Region: 160-201
Classification Level Classification E-value
Superfamily UBA-like 2.47e-20
Family UBA domain 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008168   Gene: ENSTNIG00000005475   Transcript: ENSTNIT00000008334
Sequence length 203
Comment pep:known_by_projection chromosome:TETRAODON8:18:303904:306060:-1 gene:ENSTNIG00000005475 transcript:ENSTNIT00000008334 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVVKSEETIKNQIKVELVGDNFTELRGEIAGPPDTPYEGGRYHLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAP
EPDDPQDAVVANQHPQYKQNLGMFNQTARLWSHIYAEAPISSPDYTCKIDKLCAMGFDKN
AVIAALSSKSWDVETATELLLSN
Download sequence
Identical sequences H3CIU0
99883.ENSTNIP00000008168 ENSTNIP00000008168 ENSTNIP00000008168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]