SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008197 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008197
Domain Number 1 Region: 18-128
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.97e-30
Family Ankyrin repeat 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008197   Gene: ENSTNIG00000005502   Transcript: ENSTNIT00000008363
Sequence length 228
Comment pep:novel chromosome:TETRAODON8:Un_random:17501910:17504521:1 gene:ENSTNIG00000005502 transcript:ENSTNIT00000008363 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYVFINDSSQTNVPQLQACIDGDLPFAKRLLETGCDPNIRDYRGRTGLHLAAARGNVDI
CRLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHNGSTPLVLAKRRGV
NKDAIRLLEGLEEQEVKGFNRGPHSKLETMQMADSESAMESHSLLNPNLQSSEGVLSSFR
TTWQEFVEDLGFWRVLLLLVVIALLSLGIAYYVSGVLPFSTGQLELVH
Download sequence
Identical sequences Q4SZ74
ENSTNIP00000008197 ENSTNIP00000008197 99883.ENSTNIP00000008197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]