SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008198 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008198
Domain Number 1 Region: 1551-1662
Classification Level Classification E-value
Superfamily C-type lectin-like 2.14e-43
Family Noncollagenous (NC1) domain of collagen IV 0.00000298
Further Details:      
 
Domain Number 2 Region: 1440-1547
Classification Level Classification E-value
Superfamily C-type lectin-like 2.59e-42
Family Noncollagenous (NC1) domain of collagen IV 0.00000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008198   Gene: ENSTNIG00000005503   Transcript: ENSTNIT00000008364
Sequence length 1665
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:17471203:17500080:1 gene:ENSTNIG00000005503 transcript:ENSTNIT00000008364 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPCAGLDCSSGCRCNPEKGSRGRPGLLGEAGTRGGEGPPGNPGHPGPKGEKGHPGLRGPS
GPKGDKGPMGVPGFQGNDGVPGHPGLEGGRGPPGVDGCNGTIGEPGDPGYGIGAPGYPGP
VGLPGIKGQKGEPIIISDGSIIGLPGPRGQDGRPGIRGPDGPPGFTGPSGPDGVPGPPGP
PGPPGQKGSRSDGYQGEKGDKGEVGLPGDPGQPMVNGAVEFLGFPKGHKGIQGQPGLKGL
RGFQGIPGRSGPFGYRGEKGEQGIPGYPGARVRKKQGAPGFNGPPGTLGQRGFTGNPGFP
GPSGYTGRKGDQGDPGPPGPPAYVSNGGTSVQGPPGDPGFNGSPGSRGDPGFQGLQGPPG
QPGLGGFGSGRGQPGFPGTPGPKGEKGAPGSSSFGSEGIPGSPGLTGPAGLPGPPGPSTR
HEGTDLTSNQPGIPGPPGPRGAPGNTGYKGGRGDPGDCACLGGGTSGLVGSVGLQGDNGR
PGYPGEKGEPGNPGSPGFNGIQGPPGRAGDRGFFGRKGEKGESYYPNRGLGVKGERGDLG
PRGPTGETGIPGRDGQPGSPGIPGPPGDAGYGTFGEKGFPGYPGPKGVAGGPGEPGIGYA
GTPGFRGEPGEPGIPGLPGQPGPPGPKGQVLPCSIPGEIGDPGIPGIPGRPATLGPKGQP
GFPGGSGRPGLNGAKGERGDPGFGGQPGPQGFPGPRGDPGVPGSPGQSFDGPSGKDGLPG
IPGLKGRPGEVLGATSGNPGRDGLPGFSGEKGLPGTPGAPGLPGEDGRSGIPGLKGERGI
DGLPGITGPPGPPGEPTGGIPGRPGAPGNPGTQGSPGFPGRKGERGDPGFPGPAGMKGTP
GLSGFPGSPGPAGPPGPPGPGTREGIPGIPGRKGESGFGGLRGFPGLPGRPGSPGFPGGK
GEVGDPGRNGFFGGAGYPGQKGERGYPGPPGLPSPQFPLEFADKGEPGIPGGSALPGFPG
PRGDKGLPGLPGRQGLPGLPGFAEQAKGQPGQPGFPGRPGSPGFPGLKGEAGIMGFPGSS
GLRGDDGAPGLPGEPGGYGRPGSKGQPGEVYAYPGGPGAKGERGEPGIPGGRNNDGAPGD
NGFPGNPGFPGVKGDSGEGGLPGVTGPIGFPGPKGQPGYPGRRGADGSPGLPGGPGGPGA
KGLSGAPGLDGLNGLAGPKGLPGTPGVIVGGTPGAPGIPGLKGERGVSFPGVPGFPGPKG
ERGESGLSGLPGFPGRPGLPGETVGSDIPGPPGDPGLPGPDGQYGFQGRPGPPGPPGPGT
DQGDRGDSGLPGLPGSPGRKGDPGRPAGPGAPGSAGLKGPQGETGFNGSPGLKGYPGDPG
YYGNKGPKGFKGRPGQKGIPGVTRPPIDYVRPFGDPGYPGEKETDGDLGDFGSPGLPGRL
GPKGRPGAPGKLGRIGPAGLPGPIGDPGPPGFPGSTGDQGSPGKSGPPGPPGAVGRSHSI
GYTLVKHSQDAQVPMCPQGMAKLWDGYSLLYVEGQEKAHNQDLGQPGSCLPRFSTIPFLY
CSPNEVCYYASRNDKSYWLSTTASIPMMPVAEAQIQAYISRCSVCEAPSQAVAVHSQDMT
IPTCPPGWRSLWIGYSFLMHTAAGAEGGGQSLVSPGSCLEDFRATPFIECNGAKGTCHYF
ANKYSFWLTTVDPNQEFFYSPSQETLKGGQERSKVSRCQVCSKIL
Download sequence
Identical sequences H3CIX0
ENSTNIP00000008198

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]