SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008209 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008209
Domain Number 1 Region: 220-356
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-28
Family Cadherin 0.00015
Further Details:      
 
Domain Number 2 Region: 445-572
Classification Level Classification E-value
Superfamily Cadherin-like 4.85e-23
Family Cadherin 0.00039
Further Details:      
 
Domain Number 3 Region: 338-450
Classification Level Classification E-value
Superfamily Cadherin-like 2.22e-20
Family Cadherin 0.0000822
Further Details:      
 
Domain Number 4 Region: 130-224
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000051
Family Cadherin 0.00011
Further Details:      
 
Domain Number 5 Region: 1-143
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000476
Family Cadherin 0.0034
Further Details:      
 
Domain Number 6 Region: 558-656
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000288
Family Cadherin 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008209   Gene: ENSTNIG00000003590   Transcript: ENSTNIT00000008375
Sequence length 847
Comment pep:novel chromosome:TETRAODON8:Un_random:28823886:28832974:-1 gene:ENSTNIG00000003590 transcript:ENSTNIT00000008375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CVPGFKQSTFILKVTSKHLRQQVSLGKVNFEDCTDRTRFSFSSSDGRVRAQADGALTVKR
PITLHEGHLDFLIHIWDSRGRKHTLPVRLLHQERQLGEEVAGMEAQVPVVYFHKSGEGLK
RRKRDMVIPPLNVPENHRGPYPLKISQIRSNKDDTTRIYYSISGPGANQPPVNLFTMDRV
SGTLFVTQQLDREQQASYMLKAYAVAEGSGTAEEPMDIIVNVIDQNDNKPAFVKDTFLGE
VPEASPTNFEVIQVNATDLDEPNSYNSDIRYKILSQEPKLPSDNLFTINPTTGVIRVNAG
GLDREKYPEYTLEVQAADLEGIGLTGVAKVILTVTDSNDNAPAFTQASYETSVAENKADS
QILRMLVTDGDEPHSAAWNAKFTIVSGDPGGFFSVKTGTNKQEGILSTAKGLDFEKNSKH
TLLIAVENEVPFAVALPTATATVVVTVQDVNEAPIFDPPEKQVSKGEDLPVGTDVVQYTA
SDPDTARKQKVMYRILNDPAGWLNVDKETGVIKVKTSMDRESLFVKDNKYTALIGAYDDD
EVPATGTGTLMVLLEDVNDNAPVIEERAFQVCRNKPAPQLLSVTDKDGPGNGAPFSVSLQ
DPSRSNWTARMNDSKTGIILQLTKALESGQYTVVLRVADNRGRDQDNTVQATVCECTGED
NQCQERVAAGTNLPVILGVLAGILLLLMLVLLLLMFARRRRGPQKEPLLQDTDTRDNIFY
YDEEGGGEDDQDYDLSVLHRGLDNRPEVFRNDVMPNFMPAPQYQPRPANPEEIGNFIDNN
LKTADNDPTAPPYDSLLVFDYEGGGSDSGSLSSLNSSSSGDQDYDCLSQWGPRFKKLADM
YGGGEDD
Download sequence
Identical sequences H3CIY1
ENSTNIP00000008209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]