SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008210 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008210
Domain Number 1 Region: 253-389
Classification Level Classification E-value
Superfamily Cadherin-like 2.88e-27
Family Cadherin 0.00017
Further Details:      
 
Domain Number 2 Region: 478-604
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-23
Family Cadherin 0.00041
Further Details:      
 
Domain Number 3 Region: 371-483
Classification Level Classification E-value
Superfamily Cadherin-like 6.41e-21
Family Cadherin 0.0000764
Further Details:      
 
Domain Number 4 Region: 163-257
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000366
Family Cadherin 0.0000959
Further Details:      
 
Domain Number 5 Region: 31-176
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000471
Family Cadherin 0.0045
Further Details:      
 
Domain Number 6 Region: 591-689
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000251
Family Cadherin 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008210   Gene: ENSTNIG00000005512   Transcript: ENSTNIT00000008376
Sequence length 731
Comment pep:novel chromosome:TETRAODON8:Un_random:38120169:38129645:1 gene:ENSTNIG00000005512 transcript:ENSTNIT00000008376 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EGQMGVAGARIWVFLFVAFQVSTLVTPEEQTCVPGFKQSTFILKVTSKHLRQQVSLGKVN
FEDCTDRTRFSFSSSDGRVRAQADGALTVKRPITLHEGHLDFLIHIWDSRGRKHTLPVRL
LHQERQRDEDNAEAGMEAQVPVVYFHKSGEGLKRRKRDMVIPPLSVAENYRGPYPHKISQ
IRSNQDKLWRIHYSISGPGADQPPVNLFTMDQVSGTLFVTQQLDREKQANYTLKAHAVAE
GSGTAEDPMDIIVNVIDQNDNKPGFVKDTFLGKVPEASPTNFEVIQVEATDLDEPNSDNS
DIRYKILSQEPKLPSDNLFAINEVTGAIRVNAGGLDREKYPEYTLEVQAADMKGIGLTGV
AKVILTVTDSNDNAPAFTQASYETSVAENKADSQILRMQVTDWDEPHSAAWNAKFTIVSG
DPGGFFSVKTGTNKQEGILSTAKGLDFEKNSKHTLLIAVENEVPFAVALPTATATVVVTV
QDVNEAPIFDPPEKQVSKGEDLPVGTDVVQYTASDPDTARKQKVMYRILNDPAGWLNVDK
ETGVIKVKTPMDRESLFVKDNKYTALIGAYDDDEVPATGTGTLMVLLEDVNDNAPVIEER
AFRVCRNKPAPQLLSVTDKDGPGNGAPFSVSLQDPSRSNWTARMNDSKTGIILQLTKALE
SGQYTVVLRVADNRGRDQDNTVQATVCECTGEDNQCQERVAAGTNLFFINIIRGGILLLL
TLVMLILLFAR
Download sequence
Identical sequences H3CIY2
ENSTNIP00000008210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]