SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008253 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008253
Domain Number 1 Region: 27-215,296-457
Classification Level Classification E-value
Superfamily L domain-like 1.62e-58
Family Ngr ectodomain-like 0.00058
Further Details:      
 
Domain Number 2 Region: 515-676,732-877
Classification Level Classification E-value
Superfamily L domain-like 6.32e-52
Family Ngr ectodomain-like 0.000045
Further Details:      
 
Domain Number 3 Region: 1148-1286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.48e-30
Family Laminin G-like module 0.0073
Further Details:      
 
Domain Number 4 Region: 923-963
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000863
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 5 Region: 1005-1048
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000789
Family EGF-type module 0.011
Further Details:      
 
Domain Number 6 Region: 1083-1121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000011
Family EGF-type module 0.011
Further Details:      
 
Domain Number 7 Region: 966-1005
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000312
Family EGF-type module 0.01
Further Details:      
 
Domain Number 8 Region: 1045-1082
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000288
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008253   Gene: ENSTNIG00000005554   Transcript: ENSTNIT00000008419
Sequence length 1286
Comment pep:known_by_projection chromosome:TETRAODON8:17:5135175:5198063:1 gene:ENSTNIG00000005554 transcript:ENSTNIT00000008419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FPLSPGEQSEAGPLWMWLVMLSALLMGNVGACPALCTCSGTTVDCHGLGLRSMPRNIPRN
AERLELNGNNLTRITKSDFAGLKYIRVLQLMENQITVIERGAFDDMKELERLRLNRNQLQ
QLPELLFQKNPALSRLDLSENFIQSIPRKAFRGATDIKNLQLDKNHIGCIEDGAFRAMRG
LEVLTLNNNNISSIPVSSFNHMPKLRTFRLHSNNLHCDCHLAWLAQWLRQRPTVGLFTQC
TLPAELRGLNVAEVQKHEFSCSGHQDSSGLQACSVGGGSCPAMCTCSNNIVDCRGKGLTA
IPANLPESMAEIRLEQNGIKSVPPGAFSPYKKLRRIDLSNNQISEIAPDAFQGLRSLNSL
LCVYGNKITDLPKGVFDGLYALQLLLLNANKIHCIRANAFQDLQNLSLLSLYDNKIQTLA
KGTFTSLRAIQTLHLAQNPFICDCNLKWLADYLRSNPIETSGARCASPRRLANKRIGQIK
SKKFRCSAKEQYFIPGTEDTRLNNACNSDPVCPPKCRCESNVVDCSNLKLTKVPEHIPSS
TSELRLNNNDITTLEATGAFKSLSQLKKINLSNNKITEIEDGAFEGASSVIELHLTANQI
DSVRSGMFRGLEGLRMMMLRNNKISCVHNDSFTGLHNVRLLSLYDNQLTTITPGAFDTLQ
ALSTLNLLANSFNCDCRLAWLGDWLRSRKIVTGNPRCQRPGFLKEIPLQDVALPDFRCDE
AGQEESSCVPRPQCPSECTCLETVVRCSNKHLHALPKGIPRNVTELYLDGNQFSIVPKEL
SGFKYLQLVDLSNNRINSLTNSSFSNMSQLTTLILSYNSLRCIPKMAFGGLHSLRLLSLH
GNEISELPDGIFNDVTSLSHLAIGANPLYCDCRLRWLSDWVKTGYKEPGIARCAGPQGME
GKLLLTTPAKKFECTGDVDPEVLAKCNPCLSSPCLNQGVCQSDLMEIYRCSCPPGFKGKN
CETALNACVSNPCANGGTCRVDEEEEGEYICKCPLGFEGPTCQTNADDCEDHDCENGATC
VDGVNNYTCFCPPYYTGEMCEEMEDVCAPERSPCKHQSTCLITPTGPKCVCSPGYVGDDC
SVDYNDCGDHRCQNGAQCIDELNGYSCVCHQGYSGQLCEVPPSPLSLCELADCQNNAPCV
ERGGRALCQCPPEFGGPRCEKLVSVNFVDRDSYLLLSDPKNWPQANITLQVSTAEDNGIL
LYNGDNDHIAVELYQGHVKVSYDPGSQPGHAIYSTETINDGQFHTVELVTYDQMVNLSID
GGLPTTMDSFGAVRTLNGEAPLYVGG
Download sequence
Identical sequences H3CJ24
ENSTNIP00000008253 ENSTNIP00000008253 99883.ENSTNIP00000008253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]