SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008256 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008256
Domain Number 1 Region: 9-97
Classification Level Classification E-value
Superfamily PX domain 1.31e-24
Family PX domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008256   Gene: ENSTNIG00000005557   Transcript: ENSTNIT00000008422
Sequence length 361
Comment pep:known_by_projection chromosome:TETRAODON8:3:12657892:12660760:-1 gene:ENSTNIG00000005557 transcript:ENSTNIT00000008422 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PGEEGLSLKHVEYQVTSQRYKTSVYRRYSDFDVFHEVLLQRFSYRVVPAMPPKRMLKGER
EFIEGRRRGLGRFINLVARHPIFSEDELLKTFLTFNGSDVQTKLRDAYKRTGDEFMTNRI
ATQAKEYLPADIQAQFLTSREVIKNIHNSFNRLRDRAETMAERSKENAADLLMFGRELSV
LGSDGSSLPSWASSQSSWGALRQSLKSLSVEFTVLSDKAAQQGRREEDDVVEKLSLFLDL
LQSYRDLCERHEKGVLHEHQRALHKYGVMKRQMMSATVQPKEQASVEQLESRIVQQENAI
QTMELRNYFSLFCLHQETQLIFIYLPITSHILGAFVNSQVQGHTEMGQVWNELQPKLGCL
F
Download sequence
Identical sequences H3CJ27
ENSTNIP00000008256 99883.ENSTNIP00000008256 ENSTNIP00000008256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]