SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008275 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008275
Domain Number 1 Region: 24-60
Classification Level Classification E-value
Superfamily PX domain 0.00000576
Family PX domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008275   Gene: ENSTNIG00000005576   Transcript: ENSTNIT00000008441
Sequence length 137
Comment pep:novel chromosome:TETRAODON8:21_random:61683:63129:1 gene:ENSTNIG00000005576 transcript:ENSTNIT00000008441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVTEAGCDLTYCRMRGIVAVLTAFIKERKMGLNDFIQKLVSTPHICQHVEVNNFLKIDK
NQDEDSETGPLESQVGRHSEVICTLIPAVPWLRTLRSNRQLRKGSSGSAQGNHQILRCQS
AAEENHHQKEGAKAHHG
Download sequence
Identical sequences H3CJ46
99883.ENSTNIP00000008275 ENSTNIP00000008275 ENSTNIP00000008275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]