SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008314 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008314
Domain Number 1 Region: 342-471
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-25
Family Cadherin 0.0016
Further Details:      
 
Domain Number 2 Region: 111-239
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-20
Family Cadherin 0.002
Further Details:      
 
Domain Number 3 Region: 230-346
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000314
Family Cadherin 0.0045
Further Details:      
 
Domain Number 4 Region: 29-123
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000614
Family Cadherin 0.006
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008314
Domain Number - Region: 452-526
Classification Level Classification E-value
Superfamily Cadherin-like 0.00106
Family Cadherin 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008314   Gene: ENSTNIG00000005612   Transcript: ENSTNIT00000008480
Sequence length 798
Comment pep:known_by_projection chromosome:TETRAODON8:1:2796860:2804324:-1 gene:ENSTNIG00000005612 transcript:ENSTNIT00000008480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLAMYNTLFCLLCFVSFTDANTSPTIDNFVYRVCEDTPKGELAFKINASDAENDPLTFT
LSGPNAAFFNVEKDTGRVFISQQLDRESNDVVRVNLVVSDGPNRTPGELTIIVREANDNK
PTFLESSYDATILENTPVGASLFSALATDRDISSGGIVYYSIDEVVPNSGINLFSISTTG
EVRLNGSLNYNSLSTFYQLKINATATESKKDIHGVFANTTAQVQINIIDINDNKPEFYKC
GDSCVKAAYFTGEVLEHSFGSISINMTVKDLDRAPRTLLIMDGEDKDVFSLEPQVLVSSI
NVQLVVKQPQKLDYEVKQHMVLQVIAIDEEESTFRSNATVNITIKDINDNSPTFPKDSYK
LSVPEHAPNGTVISNFTAEDPDTMDQGKITYRLLPDSILLYFNVDSRTGTVFVRNSTLLD
REVRSLHSVTLQARDSENQTGSTELEITVTDINDQYPVINRDSYQVFVKEGAKCAVEIKV
KIFLICQKRTTEGLDMKLKGKYLVTVTATDTGGLFTNTELEIFTVDESYKVELEFTSSEQ
EVEEKLNEIINALTAATKATVKIVAIRSDTAALARQGFCGNTVIVAYFVYGNGSALTSAE
VEKMLSHPDHYLILRQLGLKNIGNAPLISTEPDPLQYILLGIVAGLVIVLLVLLTTLLCT
RRNYKRKLKAAKAMKSATMVTSDNQKSAAVVPGTNKYTMEGANPVLNLNMDTAIALGLDE
ETSDVDKDSLSSLDNYEDFSKETDSVKQIIKEEDDEERNGPQVFDEPLGAALALRNKKKD
KNHFGLTLNNPAFSTTDL
Download sequence
Identical sequences H3CJ85
ENSTNIP00000008314 ENSTNIP00000008314 99883.ENSTNIP00000008314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]