SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008341 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008341
Domain Number 1 Region: 211-245
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000401
Family Plexin repeat 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008341   Gene: ENSTNIG00000005636   Transcript: ENSTNIT00000008507
Sequence length 372
Comment pep:novel chromosome:TETRAODON8:15_random:3083788:3086707:-1 gene:ENSTNIG00000005636 transcript:ENSTNIT00000008507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DHAYYTSKIYGPGDAASKELWVNSDGTWRVCAFPPSSYRQTERVTLSFGFPFYGHMLKEV
TVAAGGFIYTGDVIHQMLTATQYIAPLMANFDPSLSESSNVLYSDNGTALVVQWNRLPLR
DAIGVGTFTFQATLHSDGHIVFTYKEIPVVVTAISTETHPVKVGLADAFVVLHELEQIPD
VRRRTIYEYHKVDIPKWRISNYTAVKIFPLPTCLQFTSCGSCFTSQIGFNCSWCSRLQSR
CSSGIDRNRQDWGGPRLPGRGSRRFLRMHLPEKPLLMFVSLEKGSPVSPHRTADGTLTDA
PDAAAAKGDPEEETAGERNQHHPIGLLAGVVMVTALMIAAVFTSVYIYHHPTSTISLFFI
QRRPNRWPVLKY
Download sequence
Identical sequences H3CJB2
ENSTNIP00000008341 99883.ENSTNIP00000008341 ENSTNIP00000008341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]