SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008346 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008346
Domain Number 1 Region: 81-372
Classification Level Classification E-value
Superfamily Creatinase/aminopeptidase 1.57e-86
Family Creatinase/aminopeptidase 0.000000556
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008346
Domain Number - Region: 14-51
Classification Level Classification E-value
Superfamily HIT/MYND zinc finger-like 0.0119
Family MYND zinc finger 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008346   Gene: ENSTNIG00000005641   Transcript: ENSTNIT00000008512
Sequence length 386
Comment pep:known_by_projection chromosome:TETRAODON8:10:2546417:2551461:1 gene:ENSTNIG00000005641 transcript:ENSTNIT00000008512 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTEARRECETEACSKDAKLQCPTCIKLGIQSSYFCSQECFKGSWASHKLLHKKAKEEK
NQNESKNCLEINTDPWPGYRYTGKLRPHYPLTPMRPVPSDIQRPDYADHRSGISESERFL
KGTSQIKTLSADDIEGMRVVCELAREVLDIAAMMVKPGTTTEEIDHAVHLACTARNCYPS
PLNYYNFPKSCCTSVNEVICHGIPDRRLLQEGDILNAVDITVYHNGFHGDLNETFFVGDV
DEEAKKLVQTTYECLMQAIDSVKPGVRYRELGNIIQKHAQANGFSVVKSYCGHGIHRLFH
TAPNVPHYAKNKAVGVMKAGHVFTIEPMICEGGWQDETWPDGWTAVTKDGKRSAQFEHTL
LVTETGCEILTRRLEDNGRAHFLSQM
Download sequence
Identical sequences H3CJB7
ENSTNIP00000008346 ENSTNIP00000008346 99883.ENSTNIP00000008346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]