SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008414 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008414
Domain Number 1 Region: 25-93
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000117
Family Cadherin 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008414
Domain Number - Region: 118-146
Classification Level Classification E-value
Superfamily Cadherin-like 0.00193
Family Cadherin 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008414   Gene: ENSTNIG00000005704   Transcript: ENSTNIT00000008581
Sequence length 152
Comment pep:novel chromosome:TETRAODON8:Un_random:80097612:80098067:1 gene:ENSTNIG00000005704 transcript:ENSTNIT00000008581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKDKGLRPILLLAVFFAALDLVHGDLSYSVPEEMKRDSVIGNVAKDLGLDLRVLSSRKAR
VDFGGTRKRYCDMNLRTGDLITSERIDRESLCGKKASCLVTVDLVLENPLELHRVSLHVQ
DINDNSPQFNEDLIKMEIRESADRGGRFSIEE
Download sequence
Identical sequences H3CJI5
99883.ENSTNIP00000008414 ENSTNIP00000008414 ENSTNIP00000008414

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]