SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008457 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008457
Domain Number 1 Region: 66-219
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.28e-29
Family Ankyrin repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008457   Gene: ENSTNIG00000005744   Transcript: ENSTNIT00000008624
Sequence length 451
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:85128872:85135896:1 gene:ENSTNIG00000005744 transcript:ENSTNIT00000008624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CPGPASPAALHPEDGATDSGGFEDVDFEDLDDCRSILSDDSFYPPDDAFADSERSPSPQS
PEPLSFFRACCANNAAVVRLMIRRGVTLEEVTETDQNNRIGLLVACYQGYVDVVIALSQC
PHLDVNWQDSEGNTALITAAQAGHITITNYLLNYYLGLDIERRNCHGFTALMKAAMQGRV
ECVRSLMMAGAALNARDCGRNFTAREWALFTGRYETVWVMTRLMERPSPSQYRDNYSLEW
PPLAPLVAKAQEPRGCLKRLSDTVRQVFNIANVTNPEDEGVIDHMVSVTTAMRSPFIAVA
CHTVLPDSPPCVGKRCHAVPEIIRQQRAKELRSVNPDRVDRDRRASLQTQSLLPRNRSSS
LGAAAYGNALELRRTSLLPMHMVLRRSSIRPGFSIPKVRVSKAPTPTYKPEKIRRKSSAK
DGGGHLLQIPKWRYKELKEERRKAEEAERRR
Download sequence
Identical sequences H3CJM8
ENSTNIP00000008457 ENSTNIP00000008457 99883.ENSTNIP00000008457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]