SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008466 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000008466
Domain Number - Region: 400-454,572-602,662-686
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0547
Family Ankyrin repeat 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008466   Gene: ENSTNIG00000010220   Transcript: ENSTNIT00000008633
Sequence length 1247
Comment pep:known_by_projection chromosome:TETRAODON8:5:13206095:13213889:-1 gene:ENSTNIG00000010220 transcript:ENSTNIT00000008633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QRVWIEKTFQKRECIQVLSSKDSSRCGCGQLIVQHHPLQTGNKDEESPLVDVTVPTTERW
SVLKHTQASPTDAYGLIEFQGGGQVNKATYIRVSYDSKPDSLLHLMVKEWQLELPTLLIS
VHGGLQNFELPPKLKQVFGKGLIKAALTTGAWIFTGGVDTGVIRHVGDALKDHSSKSRGK
VCAIGMAPWGIVENKEDLVGRDVTRPYQMMSNPFSKLSALNSSHSHFILADNGTTGKYGA
EVRLRRQLEKHIALQKINTQSRLGQGVPVVCLILEGGPNVISIMLESLREEPPVPVVICD
GSGRAADIISFAHKYCEEDGMLSDNIKDQLLVTIQKTFNYSRSQAQHILLMVTECMKKKP
LITVFRMGLEGQQDIEMSILTALLKGTGTNASASDQLSLALAWNRVDIARSQIFVFGLHA
PVNSLEQAMMDALVLDRVDFVKLLIENGVNMNHFLTIPRLEELYNTKLGPVNTLHFVVRD
VKKGNLPPDYQITLIDIGLVLEVLMGGAYRCKYTRKSFRTLYNNLYGLKRPKALKLLGME
DDEPRSKGKGKKNKKKEEEVDIDVDDPEVSRFQYPFHELMVWAVLTKRQKMALFLWQHGE
EAMAKALVACKLYKAMAHESSQSELVDDIFQDLESNSREFGQLAYELLDQSYKRDEQVAM
KLLTYELKNWSNSTCLKLAVAAKHRDFIAHTCSQMLLTDMWMGCLRMGKSNSLKVILGII
FPPAILLLDFRLGEEASNPSENQESGTKDEDNKSSKVRALGAAPPFCPLRPVDVASNVDV
TSKKGDEEEEQKKSKRRTPVVKKIFEFYNAPFTKFWFNTISYLVYLMLYNYIILVKMERW
PSLQEWTVIAYIITLGLEKVRQILMSEPGKLKQKINVWLEDYWNITDLVAISVFLLGLLL
RLQNEPSMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIGKMMIDMLYFVVIMLVV
LMSFGVARQAILHPDEEPTWRLARNIFYMPYWMIYGEVFADSIDPPCGDNMYDEDGKKLP
PCIPGAWLTPAIMACYLLVANILLVNLLIAVFNNTFFEVKSISNQVWKFQRYQLIMTFHD
RPILPPPLIIFSHIFILLRRLLCPCRHRPDGERDHRERGLQLVLNPEELKSLHEFEEQCV
EEYFREKDDEKQSSNNERIRVTSERFRVENMFMRLEEVNEREHSMKASLQTVDLRLAQLE
EFSGRMMHALEKLAGVERDELLGRRSRGSSVCEAALLRHGSINSGDG
Download sequence
Identical sequences H3CJN7
ENSTNIP00000008466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]