SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008511 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008511
Domain Number 1 Region: 140-248
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9e-19
Family Synaptotagmin-like (S variant) 0.016
Further Details:      
 
Domain Number 2 Region: 7-126
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.89e-17
Family PLC-like (P variant) 0.05
Further Details:      
 
Domain Number 3 Region: 288-486
Classification Level Classification E-value
Superfamily vWA-like 7.34e-17
Family Integrin A (or I) domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008511   Gene: ENSTNIG00000005794   Transcript: ENSTNIT00000008679
Sequence length 523
Comment pep:novel chromosome:TETRAODON8:Un_random:80891525:80898127:-1 gene:ENSTNIG00000005794 transcript:ENSTNIT00000008679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKVELQLSCKGIPDRDGLSKPDPCLVLTMQSCGQWMEVGRTEVISSCGNPSFSKVFTLDF
YFEERQRLRFELFDIYSGSLYGGKHEAFLGFVECNLGQIVSQRRLSKALLQPGGTVGKSI
ITIAAEELTGNDDYIELSFSARKLDDKDFFTKSDPFLEIYRLNEDATMQLVYRTETVMNN
LNPVWKTFKVSLNSLCDGDHKRKLQVCTVWDWDSNGKHDYIGEFETMFKEMRGAIEGRQV
QWLCINSKYKAKKKNYKNSGIIILNQCIMFLYVTSPLEQLKSSEVIKMHVAIDFTASNGD
PRNSCSLHYIHPFQPNEYLKALVAVGEICQDYDSDKMFPAFGFGAQVPPDYKVSHDFAVN
FNEENPECIGIQGVVEAYQACLPKLQLYGPTNVAPIIQKVASSASQEVHTKEAMQYFILL
ILTDGVITDMADTREAIVQASHLPMSIIIVGIGNADFSDMQMLDGGEGILCSPKGEPVLR
DIVQFVPFRNFKHQATPAALAKSVLAEVPNQVVEYYNNKGIKP
Download sequence
Identical sequences H3CJT2
99883.ENSTNIP00000008511 ENSTNIP00000008511 ENSTNIP00000008511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]