SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008570 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008570
Domain Number 1 Region: 276-322
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000209
Family Plexin repeat 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008570   Gene: ENSTNIG00000005847   Transcript: ENSTNIT00000008738
Sequence length 483
Comment pep:known_by_projection chromosome:TETRAODON8:6:5169134:5189902:1 gene:ENSTNIG00000005847 transcript:ENSTNIT00000008738 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DEDTAVDLKLYSHRWRRWLPQKQRNTDSNRASQEQEPEADGPPGPLSAEDTDNSSHIEED
MDHDYYMSKTYTPADPMSRDLWVNIDHMDKEKVKIHGILSNTHRQAARVNLSFDFPFYGH
FLREITVATGGFIYTGDVVHRMLTATQYIAPLMANFDPSVSRNSTVIYFDNGTALVVQWD
HVHLQDNYNLGSFTFQATLHNTGRIVFAYKEIPIEVSQISSVNHPVKVGLSDAFVVVHKI
QQIPNVRRRTIYEYHRVELTKTKITNSTAVEMTPLPTCLQFTSCSSCVSSQISFNCSWCH
RLNRCSSGFDRHRQDWVDNSCPDETKDKMCDAADTTHLYPATTAAVARTTARTREATAGR
ALPSTSSPPTSLPTEDDTKIALHLRDNQAMPANSAVDRMSGTHPLHIGLILGILLVTLII
AAGVLVTVYVYHHPTSAASLFLIERRPSRWPAMKFRRGSGHPAYAEVEPVGQEKEGFIES
EQC
Download sequence
Identical sequences H3CJZ1
ENSTNIP00000008570 99883.ENSTNIP00000008570 ENSTNIP00000008570

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]