SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008594 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008594
Domain Number 1 Region: 444-569
Classification Level Classification E-value
Superfamily Cadherin-like 7.57e-29
Family Cadherin 0.001
Further Details:      
 
Domain Number 2 Region: 233-351
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-28
Family Cadherin 0.00041
Further Details:      
 
Domain Number 3 Region: 130-237
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-21
Family Cadherin 0.003
Further Details:      
 
Domain Number 4 Region: 343-447
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-20
Family Cadherin 0.0015
Further Details:      
 
Domain Number 5 Region: 559-668
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000143
Family Cadherin 0.0035
Further Details:      
 
Domain Number 6 Region: 30-127
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000714
Family Cadherin 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008594   Gene: ENSTNIG00000005148   Transcript: ENSTNIT00000008762
Sequence length 952
Comment pep:novel chromosome:TETRAODON8:1:6741562:6798900:1 gene:ENSTNIG00000005148 transcript:ENSTNIT00000008762 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLLLLLTPAGAMEWRALLFVWLLFLGASHGQVSYSIPEEMTKGSLVGNVAQDLGLSVARL
KSGKARIFTGNTKDTEYIGLNKDRGVLLIQERIDREALCADTTPCALHFQLILENPMEFF
RVTVEITDINDNAPNFKNAEKRFEISESAVVGAKFVLDKAIDSDIGINGLQTYTLSPTDN
FVLKLENEADGNNRVEMVLQKPLDREKHDRLSLLLTAVDGGEPQMSGTMQIFVTVLDVND
NAPTFAKPLYRAKIQENSPKGTSVITVAASDQDMGSNALVSYLISSNNRVLSDLFNINAT
TGKIILAGEIDYEKAKNYHIDIEVVDTGGLSDSAKVMIDVIDVNDNSPLIKVVTKSESIS
ENSAPNTVVAMLNVKDPDSENNGQVQCKINENIPFKIQITSNGFHTLITEVMLDREDRSE
YNITVSCSDEGAPSLSSSVTLTLQISDVNDNAPVFERSSYQAYIVENNSPGLSIFTVRAR
DADWSQNARVSYILEESSVNGVPVSSYVSVSADSGVVHAVRSFDYEQIKDFHFLVRAQDG
GSPPLSSNVSVRILIQDQNDNPPQVLYPVQTGGSMVAEMVPRSADVGYLVTKVVAVDVDS
GQNAWLSYKLQKATDRALFEVGLQNGEIRTVRQVSDKDAVKQRLSVIVEDNGQPSRSATV
IVNVAVADSFPEVLSEFTDFAQDKEYNDNLTFYLVLALAVVSFLFITCLVVIVSVKIYRW
RQSRILYHSSLPVIPYYPPRYSDTLGTGTLQHVYNYEVCRTTDSRKSDCKLGRAASQNVL
IMEPSSTGTMQRIQSDKSILDEPDSPLEQKPPNNDWRFTQGQRPGPSGETGGKTECMDRP
WPQPPTEAEQLQALMATANVSEATANLGPGTMGLSTRYSPQFTLQHVPDYRQNVYIPGST
ATLTSNPQQQQATAQQAAQQALPPPQASAQPEPPKAAQTPASKKKSTKKEKK
Download sequence
Identical sequences H3CK15
ENSTNIP00000008594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]