SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008607 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008607
Domain Number 1 Region: 272-412
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 2.62e-36
Family Outer arm dynein light chain 1 0.001
Further Details:      
 
Domain Number 2 Region: 10-104
Classification Level Classification E-value
Superfamily PX domain 5.1e-22
Family PX domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008607   Gene: ENSTNIG00000005882   Transcript: ENSTNIT00000008775
Sequence length 465
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:81874804:81877774:1 gene:ENSTNIG00000005882 transcript:ENSTNIT00000008775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LEKKVRVVGSELVENYTVYIIEVTDGQHKWTVKHRYSDFHDLHEKLKVEAKVDQRLLPPK
KMLGKNSRSLVELRQKELQLYLQTLLLQFPAAVPTPLASFLLFHLYEMEGITAALAKELF
YKGERLLQDGNVFEVRPLQLHAVSQQLRLAKPTSCHGDAKTDLGHILDFMCRLRYLKILG
GKVPVGTSNIQESRLPFDLSLFKSLHHIEINACSSQQIQGLSCMRTHLTTLSIHHGTDAM
MAILVPEASEFSQWEAEGEKSERDITAVVPVWRSLTTLDMSHNRISAIDRSVKLIPRVEF
LDLSHNQLSSVENLQHLYNLVHVDLSYNHLRLLEAAHAHLGNIKTLNLSGNQLDHLAGLA
KLYSLVNLDLSHNQLAKPDGVRSIGSLPCLEKLSLSGNPLCIIPDYRTKVLAQFGDRAAE
VCLDGQVTTEKELDTVEVLKAIQKARDAKEKMASSVAKVDLDRIL
Download sequence
Identical sequences H3CK28
ENSTNIP00000008607 99883.ENSTNIP00000008607 ENSTNIP00000008607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]