SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008619 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008619
Domain Number 1 Region: 29-165
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000174
Family Spermadhesin, CUB domain 0.0094
Further Details:      
 
Domain Number 2 Region: 176-207
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000144
Family LDL receptor-like module 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008619   Gene: ENSTNIG00000005894   Transcript: ENSTNIT00000008787
Sequence length 220
Comment pep:known_by_projection chromosome:TETRAODON8:Un_random:13533218:13535473:-1 gene:ENSTNIG00000005894 transcript:ENSTNIT00000008787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERQVIRLLLLLLSLTRRCSAIETVNVVDFCGQIIRGDGMIVNSHLESKKYYFVTMGTDC
HLTMQASSPKDKVQFHFRFFLVYSLLRVAPLLDSTSGEGSSDPCHAGSYVQFYDGRDRGS
PPLGPPLCGKSPPRPVLSTGNYLTLRLVTRGTQPRVDFVGDFTSFRLGFNQSECSSEPYF
NCRNGKCIPLSLVCDDKGIDNCGDGSDLEENLTTGCKGTS
Download sequence
Identical sequences H3CK40
99883.ENSTNIP00000008619 ENSTNIP00000008619 ENSTNIP00000008619

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]