SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008630 from Tetraodon nigroviridis 76_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008630
Domain Number 1 Region: 231-348
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-31
Family Cadherin 0.00032
Further Details:      
 
Domain Number 2 Region: 441-567
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-30
Family Cadherin 0.00081
Further Details:      
 
Domain Number 3 Region: 342-445
Classification Level Classification E-value
Superfamily Cadherin-like 1.83e-22
Family Cadherin 0.0024
Further Details:      
 
Domain Number 4 Region: 128-235
Classification Level Classification E-value
Superfamily Cadherin-like 1.38e-20
Family Cadherin 0.0043
Further Details:      
 
Domain Number 5 Region: 557-666
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000108
Family Cadherin 0.0064
Further Details:      
 
Domain Number 6 Region: 31-126
Classification Level Classification E-value
Superfamily Cadherin-like 0.000007
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008630   Gene: ENSTNIG00000005903   Transcript: ENSTNIT00000008798
Sequence length 772
Comment pep:known_by_projection chromosome:TETRAODON8:1:6722646:6725201:1 gene:ENSTNIG00000005903 transcript:ENSTNIT00000008798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGVWINARRGRWQPLIVIVCLYKLILVAGQARYSVPEEQAEGFVVGNIARDLGVDVSRL
VTGKARILAKGGRQFVDLNKDKGTLVIKERIDREQLCGKTTPCSFSFEVILENPIQLYRV
TVEVTDVNDNSPSFPKNEINLKIVESVATGTRFSLVRGNDPDVGVNDIQKYTLKPSDHFK
LEVHSQPDGEKYIEMVLQNALDREKQETHTLVLIGSDGGEPHRSGTVRIHITVLDANDNA
PVCSQPVYRAEIRENSPGGTVVTTVKATDADTGLNGEVSYSIAYVAIEASNLFAINSQTG
EIKAVGKLDFEKSKTYQLNVQASDHGGYTDTCKVIIQIIDENDNVPAIQMMSFSHSLSED
SPPGTTVAVVNVDDADSERNGVVKCSINTDVPFKMESSLTGYYSIVTEAFLDRESVSEYN
ITITVSDQGSPPLSSTKHINVKVSDVNDSPPKFDQAEYSKAVPENNSPGLSVFAVSATDA
DWGQNARLSYFLEEKEINGIAVSSLVSVNSENGVIHALKSFDYEQIKWFEFNVTARDAGS
PPLSSTATVKILIQDQNDNPPQVLYPVQTGGSMVAEMVPRSADVGYLVTKVVAVDVDSGQ
NAWLSYKLQKATDRALFEVGLQNGEIRTVRQVSDKDAVKQRLSVIVEDNGQPSRSATVIV
NVAVADSFPEVLSEFTDFAQDKEYNDNLTFYLVLALAVVSFLFITCLVVIVSVKIYRWRQ
SRILYHSSLPVIPYYPPRYSDTLGTGTLQHVYNYEVCRTTDSRKSDLVFVDP
Download sequence
Identical sequences H3CK51
99883.ENSTNIP00000008630 ENSTNIP00000008630 ENSTNIP00000008630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]